BLASTX nr result
ID: Lithospermum22_contig00039382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039382 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283664.2| PREDICTED: ribosomal RNA small subunit methy... 68 9e-10 ref|XP_002318633.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_003525181.1| PREDICTED: ribosomal RNA small subunit methy... 65 6e-09 ref|XP_004152459.1| PREDICTED: ribosomal RNA small subunit methy... 64 1e-08 ref|XP_003608919.1| Ribosomal RNA small subunit methyltransferas... 64 1e-08 >ref|XP_002283664.2| PREDICTED: ribosomal RNA small subunit methyltransferase G-like [Vitis vinifera] gi|297733841|emb|CBI15088.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 489 LDAVKSFSKYGQRTAVICLKDGPTPRKYPRDPGTPAKAPL 370 L +V+S S +GQRTA++CLKD PTPRKYPRDPGTP K+PL Sbjct: 246 LCSVESHSPFGQRTAIVCLKDCPTPRKYPRDPGTPVKSPL 285 >ref|XP_002318633.1| predicted protein [Populus trichocarpa] gi|222859306|gb|EEE96853.1| predicted protein [Populus trichocarpa] Length = 288 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 489 LDAVKSFSKYGQRTAVICLKDGPTPRKYPRDPGTPAKAPL 370 L +V+S S YGQRTA+IC KD PTPRKYPRDPGTPAK PL Sbjct: 249 LCSVESRSPYGQRTAIICSKDRPTPRKYPRDPGTPAKLPL 288 >ref|XP_003525181.1| PREDICTED: ribosomal RNA small subunit methyltransferase G-like [Glycine max] Length = 274 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 483 AVKSFSKYGQRTAVICLKDGPTPRKYPRDPGTPAKAPL 370 +V+S S YGQRTAV+C KD PTP KYPRDPGTPAK PL Sbjct: 237 SVESQSPYGQRTAVVCSKDRPTPMKYPRDPGTPAKEPL 274 >ref|XP_004152459.1| PREDICTED: ribosomal RNA small subunit methyltransferase G-like [Cucumis sativus] gi|449527787|ref|XP_004170891.1| PREDICTED: ribosomal RNA small subunit methyltransferase G-like [Cucumis sativus] Length = 281 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 480 VKSFSKYGQRTAVICLKDGPTPRKYPRDPGTPAKAPL 370 V+S S YGQRTAV+C K+ TPRKYPRDPGTPAK+PL Sbjct: 245 VESHSPYGQRTAVVCFKERHTPRKYPRDPGTPAKSPL 281 >ref|XP_003608919.1| Ribosomal RNA small subunit methyltransferase G [Medicago truncatula] gi|355509974|gb|AES91116.1| Ribosomal RNA small subunit methyltransferase G [Medicago truncatula] Length = 518 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -3 Query: 483 AVKSFSKYGQRTAVICLKDGPTPRKYPRDPGTPAKAPL**K*FVELFYSFL 331 +V+S S YGQRTAVICLKD PTP KYPR PGTP+K PL + F + Y L Sbjct: 468 SVESQSPYGQRTAVICLKDRPTPMKYPRFPGTPSKEPLTKRTFGDYDYDLL 518