BLASTX nr result
ID: Lithospermum22_contig00039363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039363 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329199.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus c... 55 8e-06 >ref|XP_002329199.1| predicted protein [Populus trichocarpa] gi|222870980|gb|EEF08111.1| predicted protein [Populus trichocarpa] Length = 1052 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = +1 Query: 4 EAAGPSSSTSRWVKPSSEIEELP--ATSGSPLHRLMGYDSPRQMLF 135 E +GPSSS S+ K SSEIEELP GSPLHRLMGY SP ++++ Sbjct: 992 ELSGPSSSMSKTKKVSSEIEELPRKGGGGSPLHRLMGYSSPSRLIY 1037 >ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus communis] gi|223540017|gb|EEF41595.1| hypothetical protein RCOM_0690150 [Ricinus communis] Length = 878 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/62 (51%), Positives = 38/62 (61%), Gaps = 4/62 (6%) Frame = +1 Query: 4 EAAGPSSSTSRWVKPSSEIEELPAT----SGSPLHRLMGYDSPRQMLFAKSEDESDDGMG 171 E+AGPS+S + SSEIEELPA+ GSPLHRLMGY SP ++F SD G Sbjct: 812 ESAGPSTSNYKLKNVSSEIEELPASPRGGGGSPLHRLMGYSSPSALVFGWG--PSDPGTS 869 Query: 172 YY 177 Y Sbjct: 870 SY 871