BLASTX nr result
ID: Lithospermum22_contig00039126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039126 (639 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19104.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002284293.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_002307403.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_004138810.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_003573696.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 >emb|CBI19104.3| unnamed protein product [Vitis vinifera] Length = 457 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +1 Query: 7 YAKNGLCAEAFKLIYRMQAEGMELDDYILSMVLTACGDFEWN 132 YA+NGLC EA KL+YRMQAEG+E+DDYIL+ VL+ACGD EWN Sbjct: 404 YARNGLCGEALKLMYRMQAEGIEVDDYILTTVLSACGDVEWN 445 >ref|XP_002284293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520-like [Vitis vinifera] Length = 595 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +1 Query: 7 YAKNGLCAEAFKLIYRMQAEGMELDDYILSMVLTACGDFEWN 132 YA+NGLC EA KL+YRMQAEG+E+DDYIL+ VL+ACGD EWN Sbjct: 542 YARNGLCGEALKLMYRMQAEGIEVDDYILTTVLSACGDVEWN 583 >ref|XP_002307403.1| predicted protein [Populus trichocarpa] gi|222856852|gb|EEE94399.1| predicted protein [Populus trichocarpa] Length = 472 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +1 Query: 7 YAKNGLCAEAFKLIYRMQAEGMELDDYILSMVLTACGDFEWN 132 Y +NGLC EA KL+YRMQAEG+++DDYI + VL ACG+ EW+ Sbjct: 419 YVRNGLCQEALKLMYRMQAEGIQVDDYISAKVLGACGEIEWD 460 >ref|XP_004138810.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520-like [Cucumis sativus] gi|449490224|ref|XP_004158542.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520-like [Cucumis sativus] Length = 619 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 7 YAKNGLCAEAFKLIYRMQAEGMELDDYILSMVLTACGD 120 YA+NGLC EA KL+YRMQAEG E+DDYIL V ACGD Sbjct: 566 YARNGLCREALKLMYRMQAEGFEVDDYILGTVYGACGD 603 >ref|XP_003573696.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520-like [Brachypodium distachyon] Length = 618 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +1 Query: 7 YAKNGLCAEAFKLIYRMQAEGMELDDYILSMVLTACGDFEW 129 +A+NGLC EAFK +Y MQ EG ++DD++LS VLT+CGD +W Sbjct: 560 FAQNGLCEEAFKYMYLMQQEGHDVDDFVLSKVLTSCGDLQW 600