BLASTX nr result
ID: Lithospermum22_contig00038902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038902 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT39952.2| Myb-like DNA-binding protein, putative [Solanum d... 69 3e-10 gb|AAT40484.1| putative Myb-like DNA-binding protein [Solanum de... 69 3e-10 gb|AAF43935.1|AC012188_12 Contains similarity to MYB-Related Pro... 65 8e-09 ref|NP_563948.1| FOUR LIPS transcription factor R2R3-MYB [Arabid... 65 8e-09 ref|XP_002271547.2| PREDICTED: uncharacterized protein LOC100246... 64 1e-08 >gb|AAT39952.2| Myb-like DNA-binding protein, putative [Solanum demissum] Length = 519 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 131 NDKNSEAPKQKERHIVSWTSEEDDILREQIEKNGTDNWTIIAS 3 N ++EA K KERHIVSW+ EEDDILREQI +GTDNWTIIAS Sbjct: 16 NGNSAEAAKPKERHIVSWSQEEDDILREQIRIHGTDNWTIIAS 58 >gb|AAT40484.1| putative Myb-like DNA-binding protein [Solanum demissum] Length = 487 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -1 Query: 131 NDKNSEAPKQKERHIVSWTSEEDDILREQIEKNGTDNWTIIAS 3 N ++EA K KERHIVSW+ EEDDILREQI +GTDNWTIIAS Sbjct: 16 NGNSAEAAKPKERHIVSWSQEEDDILREQIRIHGTDNWTIIAS 58 >gb|AAF43935.1|AC012188_12 Contains similarity to MYB-Related Protein B from Gallus gallus gi|417333 and contains two Myb-like DNA-binding PF|00249 domains [Arabidopsis thaliana] Length = 448 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -1 Query: 161 LEMKNMKKTRNDKNSEAPKQKERHIVSWTSEEDDILREQIEKNGTDNWTIIAS 3 +E KK +N N++ K+KERHIV+W+ EED ILREQI +GT+NW IIAS Sbjct: 1 MEDTKKKKKKNINNNQDSKKKERHIVTWSQEEDVILREQITLHGTENWAIIAS 53 >ref|NP_563948.1| FOUR LIPS transcription factor R2R3-MYB [Arabidopsis thaliana] gi|145323890|ref|NP_001077534.1| FOUR LIPS transcription factor R2R3-MYB [Arabidopsis thaliana] gi|15375305|gb|AAK54745.2|AF371982_1 putative transcription factor MYB124 [Arabidopsis thaliana] gi|109946607|gb|ABG48482.1| At1g14350 [Arabidopsis thaliana] gi|332191029|gb|AEE29150.1| FOUR LIPS transcription factor R2R3-MYB [Arabidopsis thaliana] gi|332191030|gb|AEE29151.1| FOUR LIPS transcription factor R2R3-MYB [Arabidopsis thaliana] Length = 436 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -1 Query: 161 LEMKNMKKTRNDKNSEAPKQKERHIVSWTSEEDDILREQIEKNGTDNWTIIAS 3 +E KK +N N++ K+KERHIV+W+ EED ILREQI +GT+NW IIAS Sbjct: 1 MEDTKKKKKKNINNNQDSKKKERHIVTWSQEEDVILREQITLHGTENWAIIAS 53 >ref|XP_002271547.2| PREDICTED: uncharacterized protein LOC100246639 [Vitis vinifera] Length = 481 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -1 Query: 146 MKKTRNDKNSEAPKQKERHIVSWTSEEDDILREQIEKNGTDNWTIIAS 3 MKK N PKQKERHIV+W+ +EDDILREQI +GT+NW IIAS Sbjct: 1 MKKKGN--TDAPPKQKERHIVTWSQQEDDILREQISLHGTENWAIIAS 46