BLASTX nr result
ID: Lithospermum22_contig00038843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038843 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22748.3| unnamed protein product [Vitis vinifera] 138 5e-31 ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containi... 138 5e-31 ref|XP_002510791.1| pentatricopeptide repeat-containing protein,... 135 5e-30 ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containi... 129 3e-28 ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containi... 129 3e-28 >emb|CBI22748.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 138 bits (347), Expect = 5e-31 Identities = 62/73 (84%), Positives = 68/73 (93%) Frame = +2 Query: 2 DKSRWAKLGYKFFIWSGQQENYRHTANAYHLIMKIFAESEEFKAMWRLVDEMIDKGYPTT 181 +K R AKLGYKFF+WSGQQENYRHT NAYHLIMKIFAES+EFKAMWRLVDEMI++G+P T Sbjct: 168 NKERCAKLGYKFFMWSGQQENYRHTVNAYHLIMKIFAESDEFKAMWRLVDEMIEQGFPVT 227 Query: 182 ARTFNILICTCGE 220 ARTF ILICTCGE Sbjct: 228 ARTFQILICTCGE 240 >ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Vitis vinifera] Length = 514 Score = 138 bits (347), Expect = 5e-31 Identities = 62/73 (84%), Positives = 68/73 (93%) Frame = +2 Query: 2 DKSRWAKLGYKFFIWSGQQENYRHTANAYHLIMKIFAESEEFKAMWRLVDEMIDKGYPTT 181 +K R AKLGYKFF+WSGQQENYRHT NAYHLIMKIFAES+EFKAMWRLVDEMI++G+P T Sbjct: 164 NKERCAKLGYKFFMWSGQQENYRHTVNAYHLIMKIFAESDEFKAMWRLVDEMIEQGFPVT 223 Query: 182 ARTFNILICTCGE 220 ARTF ILICTCGE Sbjct: 224 ARTFQILICTCGE 236 >ref|XP_002510791.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549906|gb|EEF51393.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 475 Score = 135 bits (339), Expect = 5e-30 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = +2 Query: 2 DKSRWAKLGYKFFIWSGQQENYRHTANAYHLIMKIFAESEEFKAMWRLVDEMIDKGYPTT 181 +K+R AKLGYKFFIWS QQENYRHTAN YHLIMKIFA+ EEFKAMWRL+DEM++ G+PTT Sbjct: 129 NKTRCAKLGYKFFIWSSQQENYRHTANNYHLIMKIFADCEEFKAMWRLLDEMVENGFPTT 188 Query: 182 ARTFNILICTCG 217 ARTFNILICTCG Sbjct: 189 ARTFNILICTCG 200 >ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 129 bits (323), Expect = 3e-28 Identities = 57/73 (78%), Positives = 66/73 (90%) Frame = +2 Query: 2 DKSRWAKLGYKFFIWSGQQENYRHTANAYHLIMKIFAESEEFKAMWRLVDEMIDKGYPTT 181 +K++ AKLGYKFFIWSG+ ENYRHT N+YH+IMKIFAE EEFKAMWR++DEM +KGYP T Sbjct: 126 NKTQCAKLGYKFFIWSGRIENYRHTVNSYHIIMKIFAECEEFKAMWRVLDEMTEKGYPVT 185 Query: 182 ARTFNILICTCGE 220 ARTF ILICTCGE Sbjct: 186 ARTFMILICTCGE 198 >ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 129 bits (323), Expect = 3e-28 Identities = 57/73 (78%), Positives = 66/73 (90%) Frame = +2 Query: 2 DKSRWAKLGYKFFIWSGQQENYRHTANAYHLIMKIFAESEEFKAMWRLVDEMIDKGYPTT 181 +K++ AKLGYKFFIWSG+ ENYRHT N+YH+IMKIFAE EEFKAMWR++DEM +KGYP T Sbjct: 126 NKTQCAKLGYKFFIWSGRIENYRHTVNSYHIIMKIFAECEEFKAMWRVLDEMTEKGYPVT 185 Query: 182 ARTFNILICTCGE 220 ARTF ILICTCGE Sbjct: 186 ARTFMILICTCGE 198