BLASTX nr result
ID: Lithospermum22_contig00038578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038578 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidac... 91 1e-16 ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces ... 89 5e-16 ref|ZP_07922475.1| conserved hypothetical protein, partial [Pseu... 83 2e-14 ref|ZP_07281461.1| conserved hypothetical protein [Streptomyces ... 81 4e-14 ref|ZP_06708253.1| hypothetical protein SSTG_01694 [Streptomyces... 78 8e-13 >ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] gi|325947935|gb|EGD40054.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] Length = 86 Score = 90.9 bits (224), Expect = 1e-16 Identities = 46/71 (64%), Positives = 53/71 (74%) Frame = +3 Query: 3 HYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTHVLLTRSPLEHPT 182 HY TNKLI RE IP R+ F MQ+ ++SGI+ F LSQS GQ+THVLLTRSPLE+P Sbjct: 18 HYLTNKLIGREHIPGRKTFHNHPMQEVVVSGINHRFRWLSQSLGQITHVLLTRSPLEYP- 76 Query: 183 KAGPFRSTCMC 215 GPFRSTCMC Sbjct: 77 -EGPFRSTCMC 86 >ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces sp. C] gi|302442572|gb|EFL14388.1| conserved hypothetical protein [Streptomyces sp. C] Length = 84 Score = 88.6 bits (218), Expect = 5e-16 Identities = 46/71 (64%), Positives = 51/71 (71%) Frame = +3 Query: 3 HYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTHVLLTRSPLEHPT 182 HYPTNKLI R I +RR+F P MQ +LSGI P F LSQS+GQ+ HVLLTRSPL HP Sbjct: 16 HYPTNKLIGRGLILHRRSFQLPPMQAGVLSGIRPRFQGLSQSEGQIAHVLLTRSPLIHP- 74 Query: 183 KAGPFRSTCMC 215 G RSTCMC Sbjct: 75 -EGLHRSTCMC 84 >ref|ZP_07922475.1| conserved hypothetical protein, partial [Pseudoramibacter alactolyticus ATCC 23263] gi|315620384|gb|EFV00405.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC 23263] Length = 53 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 104 QFPEVIPKSRAGYSRVTHPFATRAPHKSRAFPFDLHVL 217 QFPEVIPKSRAGYSRVTHPFATRAPHKSRAFPFDLHVL Sbjct: 1 QFPEVIPKSRAGYSRVTHPFATRAPHKSRAFPFDLHVL 38 >ref|ZP_07281461.1| conserved hypothetical protein [Streptomyces sp. AA4] gi|302438014|gb|EFL09830.1| conserved hypothetical protein [Streptomyces sp. AA4] Length = 121 Score = 80.9 bits (198), Expect(2) = 4e-14 Identities = 40/56 (71%), Positives = 43/56 (76%) Frame = +3 Query: 3 HYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTHVLLTRSPL 170 HYPTNKLI R IP RRNFP P M ++SGI PSF LSQS GQ+THVLLTRSPL Sbjct: 4 HYPTNKLIGRGFIPYRRNFPPPQMPAVVVSGIRPSFPGLSQSTGQITHVLLTRSPL 59 Score = 21.6 bits (44), Expect(2) = 4e-14 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 178 PQKQGLSVRLACVK 219 P + SVRLACVK Sbjct: 61 PGRNRFSVRLACVK 74 >ref|ZP_06708253.1| hypothetical protein SSTG_01694 [Streptomyces sp. e14] gi|294630154|ref|ZP_06708714.1| hypothetical protein SSTG_02155 [Streptomyces sp. e14] gi|292833026|gb|EFF91375.1| hypothetical protein SSTG_01694 [Streptomyces sp. e14] gi|292833487|gb|EFF91836.1| hypothetical protein SSTG_02155 [Streptomyces sp. e14] Length = 72 Score = 77.8 bits (190), Expect = 8e-13 Identities = 43/71 (60%), Positives = 50/71 (70%) Frame = +3 Query: 3 HYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTHVLLTRSPLEHPT 182 HY TNKLI R I +RR+FP M + L+SGI P F LSQS+GQ+ HVLLTRSPL PT Sbjct: 4 HYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSEGQIAHVLLTRSPL-IPT 62 Query: 183 KAGPFRSTCMC 215 + RSTCMC Sbjct: 63 EV-VHRSTCMC 72