BLASTX nr result
ID: Lithospermum22_contig00038544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038544 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF66103.1|AF198180_1 LAG1 homolog 2 [Arabidopsis thaliana] 60 2e-07 ref|NP_188557.1| LAG1 longevity assurance homolog 2 [Arabidopsis... 60 2e-07 ref|XP_002885303.1| hypothetical protein ARALYDRAFT_318682 [Arab... 60 2e-07 gb|AEY81371.1| longevity assurance protein 1-like protein [Gossy... 59 4e-07 ref|XP_002518765.1| longevity assurance factor, putative [Ricinu... 58 7e-07 >gb|AAF66103.1|AF198180_1 LAG1 homolog 2 [Arabidopsis thaliana] Length = 297 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 54 VLRFYPF*CSFFRVGCIILALHDGSDVFLESVKVFKYSEKE 176 +L Y + SFFR+G IILALHD SDVF+E+ K+FKYSEKE Sbjct: 159 ILLSYSYLTSFFRIGAIILALHDASDVFMETAKIFKYSEKE 199 >ref|NP_188557.1| LAG1 longevity assurance homolog 2 [Arabidopsis thaliana] gi|62900623|sp|Q9LJK3.1|LAG12_ARATH RecName: Full=LAG1 longevity assurance homolog 2; Short=LAG1 homolog 2 gi|9294628|dbj|BAB02967.1| unnamed protein product [Arabidopsis thaliana] gi|21537198|gb|AAM61539.1| longevity factor-like protein [Arabidopsis thaliana] gi|26451114|dbj|BAC42661.1| putative longevity factor [Arabidopsis thaliana] gi|30725356|gb|AAP37700.1| At3g19260 [Arabidopsis thaliana] gi|332642693|gb|AEE76214.1| LAG1 longevity assurance homolog 2 [Arabidopsis thaliana] Length = 296 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 54 VLRFYPF*CSFFRVGCIILALHDGSDVFLESVKVFKYSEKE 176 +L Y + SFFR+G IILALHD SDVF+E+ K+FKYSEKE Sbjct: 159 ILLSYSYLTSFFRIGAIILALHDASDVFMETAKIFKYSEKE 199 >ref|XP_002885303.1| hypothetical protein ARALYDRAFT_318682 [Arabidopsis lyrata subsp. lyrata] gi|297331143|gb|EFH61562.1| hypothetical protein ARALYDRAFT_318682 [Arabidopsis lyrata subsp. lyrata] Length = 279 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 54 VLRFYPF*CSFFRVGCIILALHDGSDVFLESVKVFKYSEKE 176 +L Y + SFFR+G IILALHD SDVF+E+ K+FKYSEKE Sbjct: 143 ILLSYSYLTSFFRIGAIILALHDASDVFMETAKIFKYSEKE 183 >gb|AEY81371.1| longevity assurance protein 1-like protein [Gossypium hirsutum] Length = 289 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +3 Query: 39 YMYSQVLRFYPF*CSFFRVGCIILALHDGSDVFLESVKVFKYSEKEV 179 ++ + +L Y + SFFR+G IILALHD SDVFLE+ KVFKYSE E+ Sbjct: 148 HVITVILIGYSYITSFFRIGSIILALHDASDVFLEAAKVFKYSESEL 194 >ref|XP_002518765.1| longevity assurance factor, putative [Ricinus communis] gi|223542146|gb|EEF43690.1| longevity assurance factor, putative [Ricinus communis] Length = 315 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 66 YPF*CSFFRVGCIILALHDGSDVFLESVKVFKYSEKEVEFLLF 194 Y + SFFR+G IILALHD SDVFLE+ KVFKYS KE+ +F Sbjct: 157 YSYITSFFRIGSIILALHDASDVFLEAAKVFKYSGKELGASIF 199