BLASTX nr result
ID: Lithospermum22_contig00038376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038376 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509807.1| kinesin heavy chain, putative [Ricinus commu... 60 2e-07 gb|AAG52420.1|AC011622_8 kinesin-like protein; 73641-79546 [Arab... 59 4e-07 gb|AAF19694.1|AC008047_1 F2K11.1 [Arabidopsis thaliana] 59 4e-07 ref|NP_974079.1| kinesin motor, calponin homology and calcium bi... 59 4e-07 ref|XP_003541794.1| PREDICTED: kinesin-like protein 2-like [Glyc... 59 4e-07 >ref|XP_002509807.1| kinesin heavy chain, putative [Ricinus communis] gi|223549706|gb|EEF51194.1| kinesin heavy chain, putative [Ricinus communis] Length = 1069 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LKFAERVSGVELGAAKSSKEGRDFRELVEQVTSL 104 LKFAERVSGVELGAA+S+KEGRD REL++QVTSL Sbjct: 768 LKFAERVSGVELGAARSNKEGRDIRELMQQVTSL 801 >gb|AAG52420.1|AC011622_8 kinesin-like protein; 73641-79546 [Arabidopsis thaliana] Length = 1056 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LKFAERVSGVELGAAKSSKEGRDFRELVEQVTSL 104 LKFAERVSGVELGAAKSSKEGRD R+L+EQV++L Sbjct: 776 LKFAERVSGVELGAAKSSKEGRDVRQLMEQVSNL 809 >gb|AAF19694.1|AC008047_1 F2K11.1 [Arabidopsis thaliana] Length = 1109 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LKFAERVSGVELGAAKSSKEGRDFRELVEQVTSL 104 LKFAERVSGVELGAAKSSKEGRD R+L+EQV++L Sbjct: 812 LKFAERVSGVELGAAKSSKEGRDVRQLMEQVSNL 845 >ref|NP_974079.1| kinesin motor, calponin homology and calcium binding and coiled-coil domain-containing protein [Arabidopsis thaliana] gi|332196002|gb|AEE34123.1| kinesin motor, calponin homology and calcium binding and coiled-coil domain-containing protein [Arabidopsis thaliana] Length = 1065 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LKFAERVSGVELGAAKSSKEGRDFRELVEQVTSL 104 LKFAERVSGVELGAAKSSKEGRD R+L+EQV++L Sbjct: 784 LKFAERVSGVELGAAKSSKEGRDVRQLMEQVSNL 817 >ref|XP_003541794.1| PREDICTED: kinesin-like protein 2-like [Glycine max] Length = 910 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 LKFAERVSGVELGAAKSSKEGRDFRELVEQVTSL 104 LKFAERVSGVELGAAKS+K+GRD REL+EQV+SL Sbjct: 840 LKFAERVSGVELGAAKSTKDGRDVRELMEQVSSL 873