BLASTX nr result
ID: Lithospermum22_contig00038239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038239 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529949.1| heat shock protein binding protein, putative... 161 6e-38 ref|XP_003531518.1| PREDICTED: uncharacterized protein LOC100817... 160 8e-38 ref|XP_003596006.1| Chaperone protein dnaJ [Medicago truncatula]... 160 1e-37 ref|XP_003546782.1| PREDICTED: uncharacterized protein LOC100779... 159 2e-37 ref|XP_004171734.1| PREDICTED: uncharacterized LOC101216675 [Cuc... 158 4e-37 >ref|XP_002529949.1| heat shock protein binding protein, putative [Ricinus communis] gi|223530547|gb|EEF32426.1| heat shock protein binding protein, putative [Ricinus communis] Length = 554 Score = 161 bits (407), Expect = 6e-38 Identities = 69/78 (88%), Positives = 73/78 (93%) Frame = +1 Query: 1 IQCTKCGTSHIWVCTNRSKTKSRWCQDCCQYHQAKNGDGWVEYKGSLVFDGPKKVEIPCA 180 IQCTKCG SHIWVCTNRSK K+RWCQDCCQYHQAK+GDGWVEYKGSLVFD P+K+EIP A Sbjct: 389 IQCTKCGNSHIWVCTNRSKAKARWCQDCCQYHQAKDGDGWVEYKGSLVFDKPQKMEIPRA 448 Query: 181 FVCAEDKIFDVSEWAICQ 234 FVCAE KIFDVSEWAICQ Sbjct: 449 FVCAESKIFDVSEWAICQ 466 >ref|XP_003531518.1| PREDICTED: uncharacterized protein LOC100817237 [Glycine max] Length = 562 Score = 160 bits (406), Expect = 8e-38 Identities = 69/78 (88%), Positives = 73/78 (93%) Frame = +1 Query: 1 IQCTKCGTSHIWVCTNRSKTKSRWCQDCCQYHQAKNGDGWVEYKGSLVFDGPKKVEIPCA 180 IQCTKCG SHIWVCTNRSK K+RWCQDCCQ+HQAK+GDGWVEYKGSLVFD P+KVEIP A Sbjct: 396 IQCTKCGNSHIWVCTNRSKAKARWCQDCCQFHQAKDGDGWVEYKGSLVFDRPQKVEIPRA 455 Query: 181 FVCAEDKIFDVSEWAICQ 234 FVCAE KIFDVSEWAICQ Sbjct: 456 FVCAESKIFDVSEWAICQ 473 >ref|XP_003596006.1| Chaperone protein dnaJ [Medicago truncatula] gi|355485054|gb|AES66257.1| Chaperone protein dnaJ [Medicago truncatula] Length = 589 Score = 160 bits (405), Expect = 1e-37 Identities = 68/78 (87%), Positives = 73/78 (93%) Frame = +1 Query: 1 IQCTKCGTSHIWVCTNRSKTKSRWCQDCCQYHQAKNGDGWVEYKGSLVFDGPKKVEIPCA 180 IQCTKCG SH+WVCTNRSK K+RWCQDCCQ+HQAK+GDGWVEYKGSLVFD P+KVEIP A Sbjct: 422 IQCTKCGNSHVWVCTNRSKAKARWCQDCCQFHQAKDGDGWVEYKGSLVFDRPQKVEIPRA 481 Query: 181 FVCAEDKIFDVSEWAICQ 234 FVCAE KIFDVSEWAICQ Sbjct: 482 FVCAESKIFDVSEWAICQ 499 >ref|XP_003546782.1| PREDICTED: uncharacterized protein LOC100779992 [Glycine max] Length = 561 Score = 159 bits (403), Expect = 2e-37 Identities = 68/78 (87%), Positives = 73/78 (93%) Frame = +1 Query: 1 IQCTKCGTSHIWVCTNRSKTKSRWCQDCCQYHQAKNGDGWVEYKGSLVFDGPKKVEIPCA 180 IQCTKCG SHIWVCTNR+K K+RWCQDCCQ+HQAK+GDGWVEYKGSLVFD P+KVEIP A Sbjct: 395 IQCTKCGNSHIWVCTNRNKAKARWCQDCCQFHQAKDGDGWVEYKGSLVFDRPQKVEIPRA 454 Query: 181 FVCAEDKIFDVSEWAICQ 234 FVCAE KIFDVSEWAICQ Sbjct: 455 FVCAESKIFDVSEWAICQ 472 >ref|XP_004171734.1| PREDICTED: uncharacterized LOC101216675 [Cucumis sativus] Length = 557 Score = 158 bits (400), Expect = 4e-37 Identities = 67/78 (85%), Positives = 74/78 (94%) Frame = +1 Query: 1 IQCTKCGTSHIWVCTNRSKTKSRWCQDCCQYHQAKNGDGWVEYKGSLVFDGPKKVEIPCA 180 IQC+KCG SHIWVCTNR+KTK+RWCQDCCQYHQAK+GDGWVEYKGSLVFD P+K++IP A Sbjct: 390 IQCSKCGHSHIWVCTNRNKTKARWCQDCCQYHQAKDGDGWVEYKGSLVFDKPQKMDIPRA 449 Query: 181 FVCAEDKIFDVSEWAICQ 234 FVCAE KIFDVSEWAICQ Sbjct: 450 FVCAESKIFDVSEWAICQ 467