BLASTX nr result
ID: Lithospermum22_contig00038129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00038129 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_172393.2| pentatricopeptide repeat-containing protein [Ar... 55 6e-06 >ref|NP_172393.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75116771|sp|Q680Z7.1|PPR24_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09220, mitochondrial; Flags: Precursor gi|51969004|dbj|BAD43194.1| hypothetical protein [Arabidopsis thaliana] gi|51969582|dbj|BAD43483.1| hypothetical protein [Arabidopsis thaliana] gi|51969876|dbj|BAD43630.1| hypothetical protein [Arabidopsis thaliana] gi|62318861|dbj|BAD93927.1| hypothetical protein [Arabidopsis thaliana] gi|332190294|gb|AEE28415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 504 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 1/90 (1%) Frame = -2 Query: 269 SLLQKHKHNLKAIQQVHSHXXXXXXXXXXXXXXXXXXXLFNFIVRSYSINTCPQQAFYLF 90 SL+QK++ NLK I Q+HSH LFN ++R YS+ P A++L+ Sbjct: 41 SLMQKYESNLKIIHQLHSHFTTSGFLLLHQKQNSGKLFLFNPLLRCYSLGETPLHAYFLY 100 Query: 89 KQLQTNNY-DNPIVYFRCFDGFTYSFLIKA 3 QLQ ++ + FD FTY FL+KA Sbjct: 101 DQLQRLHFLSDHNKSLPPFDSFTYLFLLKA 130