BLASTX nr result
ID: Lithospermum22_contig00037994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037994 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10338.1| hypothetical protein [Arabidopsis thaliana] gi|7... 56 3e-06 gb|AAD37019.2| putative non-LTR retrolelement reverse transcript... 55 6e-06 >emb|CAB10338.1| hypothetical protein [Arabidopsis thaliana] gi|7268308|emb|CAB78602.1| hypothetical protein [Arabidopsis thaliana] Length = 655 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Frame = -1 Query: 271 KKYIFIECVCEDDFNRIWLKLKWVIEGYVMRVFKWSPDFSPLKES-SIAPVWIRVVGLPL 95 +++ + E+D+ W + G ++ V WSP+F+PL++ PVW+RV LP+ Sbjct: 131 RQFFMVRFEVEEDYMMALTGGPWRVLGSILMVQAWSPEFNPLRDVIETTPVWVRVANLPV 190 Query: 94 YLFDEMSLRSISNSIGRPIRVD 29 + L I+ +G+PI+VD Sbjct: 191 TFYHNEILLGIAAGLGKPIKVD 212 >gb|AAD37019.2| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 855 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = -1 Query: 268 KYIFIECVCEDDFNRIWLKLKWVIEGYVMRVFKWSPDFSPLK-ESSIAPVWIRVVGLPLY 92 ++ I ED++ W G + V WSP+F PL+ E + P+W+R++ +PL Sbjct: 92 QFFMIRFEREDEYLSALTGGPWRAFGSYLLVQAWSPEFDPLRDEITTTPIWVRLMNIPLS 151 Query: 91 LFDEMSLRSISNSIGRPIRVD 29 L+ L I+ S+G+P++VD Sbjct: 152 LYHTSILMGIAGSLGKPVKVD 172