BLASTX nr result
ID: Lithospermum22_contig00037986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037986 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154891.1| PREDICTED: pentatricopeptide repeat-containi... 50 4e-06 ref|XP_004147828.1| PREDICTED: pentatricopeptide repeat-containi... 50 4e-06 >ref|XP_004154891.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Cucumis sativus] Length = 759 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 21/50 (42%), Positives = 33/50 (66%) Frame = -2 Query: 252 IVQLLDEVTNLKRLKQIHAYFIRNSLQIHHDIWVAQLLTLCTRFHAPPLY 103 +V L +++N+++L+Q H + + NSL H+ WV+ LL CTR HA P Y Sbjct: 4 LVALASKISNIRQLRQFHGHLVHNSLH-SHNYWVSLLLINCTRLHAHPAY 52 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 101 PAAYASVFKNMFRYYSSCGTSTNIHALF 18 P+ ASV+ M +YYS G + +LF Sbjct: 61 PSPDASVYSCMLKYYSRMGAHNQVVSLF 88 >ref|XP_004147828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Cucumis sativus] Length = 759 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 21/50 (42%), Positives = 33/50 (66%) Frame = -2 Query: 252 IVQLLDEVTNLKRLKQIHAYFIRNSLQIHHDIWVAQLLTLCTRFHAPPLY 103 +V L +++N+++L+Q H + + NSL H+ WV+ LL CTR HA P Y Sbjct: 4 LVALASKISNIRQLRQFHGHLVHNSLH-SHNYWVSLLLINCTRLHAHPAY 52 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 101 PAAYASVFKNMFRYYSSCGTSTNIHALF 18 P+ ASV+ M +YYS G + +LF Sbjct: 61 PSPDASVYSCMLKYYSRMGAHNQVVSLF 88