BLASTX nr result
ID: Lithospermum22_contig00037900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037900 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulga... 56 3e-06 >emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1363 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/81 (32%), Positives = 47/81 (58%) Frame = +2 Query: 20 NIIMERLNWAFGSQSWRTIFSRAEVNHLIRITSDHNPILVNLLPSNNLTRSTPFKLQQMW 199 ++I ERL+ A + W +F +V HL R SDH P+L+ L N + S PF+ +++W Sbjct: 192 SLIKERLDRALVNSEWLDLFPDTKVIHLPRTFSDHCPLLI-LFNENPRSESFPFRCKEVW 250 Query: 200 FTHPDLANLVDKSLNGENSPF 262 HPD N+++++ ++ + Sbjct: 251 AYHPDFTNVIEETWGSHHNSY 271