BLASTX nr result
ID: Lithospermum22_contig00037802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037802 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB87727.1| hydroxy-methylglutaryl-coenzyme A reductase [Nico... 62 4e-08 gb|AEU08408.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 62 5e-08 gb|ADJ18178.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 62 6e-08 gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 61 8e-08 dbj|BAE92731.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase ... 60 1e-07 >gb|AAB87727.1| hydroxy-methylglutaryl-coenzyme A reductase [Nicotiana tabacum] Length = 604 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 ELSLMSAISAGQLVKSHMKYNRSSKDVTKVSS 98 ELSLMSAISAGQLVKSHMKYNRSSKDVTK+SS Sbjct: 573 ELSLMSAISAGQLVKSHMKYNRSSKDVTKISS 604 >gb|AEU08408.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Clematis armandii] Length = 578 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 ELSLMSAISAGQLVKSHMKYNRSSKDVTKVSS 98 ELSLMSAISAGQLVKSHMKYNRSSKD+TK+SS Sbjct: 547 ELSLMSAISAGQLVKSHMKYNRSSKDITKISS 578 >gb|ADJ18178.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eucalyptus grandis x Eucalyptus urophylla] Length = 519 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 ELSLMSAISAGQLVKSHMKYNRSSKDVTKVSS 98 ELSLMSAI+AGQLVKSHMKYNRSSKDVTKVSS Sbjct: 488 ELSLMSAIAAGQLVKSHMKYNRSSKDVTKVSS 519 >gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camptotheca acuminata] Length = 589 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 ELSLMSAISAGQLVKSHMKYNRSSKDVTKVSS 98 ELSLMSAI+AGQLVKSHMKYNRSSKD+TKVSS Sbjct: 558 ELSLMSAIAAGQLVKSHMKYNRSSKDITKVSS 589 >dbj|BAE92731.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Gentiana lutea] Length = 549 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 ELSLMSAISAGQLVKSHMKYNRSSKDVTKVSS 98 ELSLMSAISAGQLVKSHMKYNRSSKD TK+SS Sbjct: 518 ELSLMSAISAGQLVKSHMKYNRSSKDFTKISS 549