BLASTX nr result
ID: Lithospermum22_contig00037724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037724 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW73605.1| hypothetical protein ZEAMMB73_117146 [Zea mays] 62 6e-08 gb|AFW61967.1| hypothetical protein ZEAMMB73_362459 [Zea mays] 59 3e-07 >gb|AFW73605.1| hypothetical protein ZEAMMB73_117146 [Zea mays] Length = 51 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 RIAGIEPASLAWKARGYSRRRFSILNVSNSKPNMK 107 R+AGIEPASLAWKARGYSRR I +VSNSKPNMK Sbjct: 16 RVAGIEPASLAWKARGYSRRWLIIFDVSNSKPNMK 50 >gb|AFW61967.1| hypothetical protein ZEAMMB73_362459 [Zea mays] Length = 51 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 RIAGIEPASLAWKARGYSRRRFSILNVSNSKPNMK 107 R+AGIEPA LAWKARGYSRR I +VSNSKPNMK Sbjct: 16 RVAGIEPALLAWKARGYSRRWLIIFDVSNSKPNMK 50