BLASTX nr result
ID: Lithospermum22_contig00037685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037685 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33895.1| hypothetical protein [Cucumis melo subsp. melo] 59 4e-07 >gb|ADN33895.1| hypothetical protein [Cucumis melo subsp. melo] Length = 458 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = +2 Query: 2 KLRVGRLPRESPRDSGPAKKIVELIGRKPYFSRHDEMEQLVCQSLSFTEEGDE 160 ++R R SPRDSGPAK++ ELIG K F +EME L+CQ L+F E+ +E Sbjct: 406 RIRTTRCANMSPRDSGPAKRVSELIGSKTSFFADEEMEALICQKLNFAEDEEE 458