BLASTX nr result
ID: Lithospermum22_contig00037664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037664 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519858.1| hypothetical protein RCOM_0865530 [Ricinus c... 55 6e-06 >ref|XP_002519858.1| hypothetical protein RCOM_0865530 [Ricinus communis] gi|223540904|gb|EEF42462.1| hypothetical protein RCOM_0865530 [Ricinus communis] Length = 174 Score = 55.1 bits (131), Expect = 6e-06 Identities = 37/97 (38%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +2 Query: 50 SFLNPTD-RLAS-IGTIRLGLRTVFNAD----FGRIVQTNGMMKTFRNGKEGMTISALLM 211 S LN D RL T ++GL V D GRI +GM+K G +G IS +L+ Sbjct: 59 SMLNLVDHRLRGYFATAKVGLANVLKVDKWKGLGRITLVDGMIKMLHTGIKGEKISTVLI 118 Query: 212 DANRLSRDIPDFLHQSKKELELFVLFDPTFESLPLPL 322 D + LSR++P Q ELE+ LF P + LP L Sbjct: 119 DGSHLSREVPQTFFQHMCELEVLALFYPRLKFLPSSL 155