BLASTX nr result
ID: Lithospermum22_contig00037643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037643 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605315.1| hypothetical protein MTR_4g028480 [Medicago ... 71 2e-13 ref|XP_003590237.1| hypothetical protein MTR_1g050420 [Medicago ... 69 3e-12 ref|XP_003628147.1| Ulp1 protease family C-terminal catalytic do... 71 1e-10 ref|XP_003635782.1| hypothetical protein MTR_008s0014 [Medicago ... 64 1e-08 ref|XP_003599544.1| hypothetical protein MTR_3g034960 [Medicago ... 63 3e-08 >ref|XP_003605315.1| hypothetical protein MTR_4g028480 [Medicago truncatula] gi|355506370|gb|AES87512.1| hypothetical protein MTR_4g028480 [Medicago truncatula] Length = 371 Score = 70.9 bits (172), Expect(2) = 2e-13 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +2 Query: 2 TLQKDEWVSSFVINGWINCLNWKQPNNNRSRVFTPLLNYISI 127 TLQKDEWVS FVIN W+NCLNW QPN +R+ TP +NY+ + Sbjct: 275 TLQKDEWVSCFVINAWVNCLNWNQPNEKMTRLVTPFINYVDM 316 Score = 29.6 bits (65), Expect(2) = 2e-13 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +1 Query: 223 VNDTRSVA*CLKTFMERLKGFNYMNFRSID 312 +N T+ VA K F+ERLK F YM++++ID Sbjct: 322 LNITKPVA--CKRFIERLKKFKYMDWKAID 349 >ref|XP_003590237.1| hypothetical protein MTR_1g050420 [Medicago truncatula] gi|355479285|gb|AES60488.1| hypothetical protein MTR_1g050420 [Medicago truncatula] Length = 717 Score = 69.3 bits (168), Expect(2) = 3e-12 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 2 TLQKDEWVSSFVINGWINCLNWKQPNNNRSRVFTPLLNYISIVFV 136 +LQKDEWVS FVIN W+NCLNW QPN +R+ TP +NY+ + + Sbjct: 472 SLQKDEWVSCFVINAWVNCLNWSQPNEKMTRLVTPFINYVFLELI 516 Score = 26.9 bits (58), Expect(2) = 3e-12 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 193 YE*TDMIGLDVND-TRSVA*CLKTFMERLKGFNYMNFRSID 312 Y+ D+ D D T SVA K F+ RLK F YM++++ID Sbjct: 521 YKQVDLERPDALDITNSVA--CKRFIGRLKKFKYMDWKAID 559 >ref|XP_003628147.1| Ulp1 protease family C-terminal catalytic domain containing protein expressed [Medicago truncatula] gi|355522169|gb|AET02623.1| Ulp1 protease family C-terminal catalytic domain containing protein expressed [Medicago truncatula] Length = 660 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 2 TLQKDEWVSSFVINGWINCLNWKQPNNNRSRVFTPLLNYI-SIVFVEY*KFRYCC 163 +LQKDEWVS FVIN W+NCLNW QPN +R+ TP +NYI ++ + F Y C Sbjct: 522 SLQKDEWVSCFVINAWVNCLNWSQPNEKMTRLVTPFINYIMTLALIGDPGFHYVC 576 >ref|XP_003635782.1| hypothetical protein MTR_008s0014 [Medicago truncatula] gi|355501717|gb|AES82920.1| hypothetical protein MTR_008s0014 [Medicago truncatula] Length = 897 Score = 63.9 bits (154), Expect = 1e-08 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = +2 Query: 2 TLQKDEWVSSFVINGWINCLNWKQPNNNRSRVFTPLLNYISI 127 +LQ+DEWVS FVIN W+NCLNW Q + +R+ TP++NY+ + Sbjct: 645 SLQQDEWVSCFVINAWVNCLNWNQQRDKMTRLVTPMINYVDL 686 >ref|XP_003599544.1| hypothetical protein MTR_3g034960 [Medicago truncatula] gi|355488592|gb|AES69795.1| hypothetical protein MTR_3g034960 [Medicago truncatula] Length = 587 Score = 62.8 bits (151), Expect = 3e-08 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = +2 Query: 2 TLQKDEWVSSFVINGWINCLNWKQPNNNRSRVFTPLLNYISI 127 +LQ+DEWVS FVIN W+NCLNW Q + +R+ TP++NY+ + Sbjct: 325 SLQQDEWVSCFVINVWVNCLNWNQQRDKMTRLVTPMINYVDL 366