BLASTX nr result
ID: Lithospermum22_contig00037501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037501 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 61 8e-08 gb|AFK45340.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 59 5e-07 ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = -2 Query: 167 FAFIFSHCYGSRNSNVFNWEPNHQPSSGHYSNYMPKRM-VPASGPSRKHNNIGLQS 3 F F + +GSR++NVFN++P Q GH+ N++P+ + +P SGPSR+HN IGLQ+ Sbjct: 20 FIFFVGYSHGSRSTNVFNFKPKTQ-YKGHFLNFLPRHLPIPTSGPSRRHNGIGLQN 74 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -2 Query: 167 FAFIFSHCYGSRNSNVFNWEPNHQPSSGHYSNYMPKRM-VPASGPSRKHNNIGLQS 3 F IF HC GSR +NVF +P ++ GH+ ++P+R+ +P S PSRKHN+IGLQS Sbjct: 18 FLCIFGHCDGSRATNVFKVKPKYE-HKGHFFGFLPRRIPIPYSSPSRKHNDIGLQS 72 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -2 Query: 167 FAFIFSHCYGSRNSNVFNWEPNHQPSSGHYSNYMPKRM-VPASGPSRKHNNIGLQS 3 F IF HC GSR +NVF +P ++ GH+ ++P R+ +P S PSRKHN+IGLQS Sbjct: 18 FLCIFGHCDGSRATNVFKVKPKYE-HKGHFFGFLPGRIPIPYSSPSRKHNDIGLQS 72 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = -2 Query: 206 RRPXXXXXXXXXVFAFIFSHCYGSRNSNVFNWEPNHQPSSGHYSNYMPKRM-VPASGPSR 30 RRP + FI C+GSR +N F +P + GH+ ++PKRM +P S PSR Sbjct: 5 RRPLQLLVIWLLLILFILGQCHGSRTTNDFKVKPKSE-HQGHFFGFLPKRMHIPYSTPSR 63 Query: 29 KHNNIGLQS 3 KHN+IGL+S Sbjct: 64 KHNDIGLRS 72 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/57 (49%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = -2 Query: 167 FAFIFSHCYGSRNS-NVFNWEPNHQPSSGHYSNYMPKRM-VPASGPSRKHNNIGLQS 3 F F +C+GSR + NVF+ +P +Q GH+ N++P+ +P SGPSR+HN+IGLQS Sbjct: 28 FISFFGYCHGSRTTANVFDVKPKNQ-HRGHFLNFLPRHFPIPTSGPSRRHNDIGLQS 83