BLASTX nr result
ID: Lithospermum22_contig00037308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037308 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267684.1| PREDICTED: pentatricopeptide repeat-containi... 65 8e-09 emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] 63 3e-08 ref|XP_002298921.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002267684.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Vitis vinifera] Length = 393 Score = 64.7 bits (156), Expect = 8e-09 Identities = 26/64 (40%), Positives = 46/64 (71%) Frame = +3 Query: 156 IIQRSNLCYKVAPPNSSKLVNNKDWLSPSQTINIFNNLQDPNSALQLLDQISQRKDYTPN 335 +IQ+S + PP+ K +++KDWLSP + + IF+ L++P S + +LD +S+RKD+ PN Sbjct: 26 LIQKSTF-FSTFPPDDLKRLDHKDWLSPREVLKIFDGLRNPESVMPVLDSVSKRKDFKPN 84 Query: 336 QSIY 347 +++Y Sbjct: 85 EALY 88 >emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] Length = 393 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/64 (39%), Positives = 46/64 (71%) Frame = +3 Query: 156 IIQRSNLCYKVAPPNSSKLVNNKDWLSPSQTINIFNNLQDPNSALQLLDQISQRKDYTPN 335 +IQ+S + + PP+ K +++KDWLSP + + IF+ L++P S + +LD + +RKD+ PN Sbjct: 26 LIQKS-IFFSTFPPDDLKRLDHKDWLSPREVLKIFDGLRNPESVMPVLDSVCKRKDFKPN 84 Query: 336 QSIY 347 +++Y Sbjct: 85 EALY 88 >ref|XP_002298921.1| predicted protein [Populus trichocarpa] gi|222846179|gb|EEE83726.1| predicted protein [Populus trichocarpa] Length = 326 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = +3 Query: 213 VNNKDWLSPSQTINIFNNLQDPNSALQLLDQISQRKDYTPNQSIY 347 + +KDWLSP++ I IF NL+DPNS + + +Q S+RKDY PN+++Y Sbjct: 2 LTHKDWLSPNEVIKIFENLKDPNSIISVWNQYSKRKDYKPNEALY 46 >ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] gi|449503658|ref|XP_004162112.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] Length = 411 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 213 VNNKDWLSPSQTINIFNNLQDPNSALQLLDQISQRKDYTPNQSIY 347 ++++DWLSP++ INI +Q P+S L L Q S RKDY PN+ IY Sbjct: 50 LSHRDWLSPNEVINIIQQIQHPSSVLAFLHQWSNRKDYKPNKEIY 94