BLASTX nr result
ID: Lithospermum22_contig00037272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037272 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB72467.1| putative protein [Arabidopsis thaliana] 53 8e-06 >emb|CAB72467.1| putative protein [Arabidopsis thaliana] Length = 762 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +2 Query: 5 EIRQKIDGWKNKHLSFVGRIVLLDFVIFGICNYWCQTVFIPKGIIQEIEKM 157 +IR++I W ++ LSF GR L+ +I+ CN+W +P+ IQEIEK+ Sbjct: 345 QIRKRIGSWSSRFLSFAGRFNLISSIIWSSCNFWLSAFQLPRACIQEIEKL 395 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 163 NFLWKGTSFGKYLSKTS*NRL 225 +FLW GT+ +K S N++ Sbjct: 398 SFLWSGTNLNSKKAKISWNQV 418