BLASTX nr result
ID: Lithospermum22_contig00037091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037091 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25132.3| unnamed protein product [Vitis vinifera] 73 3e-11 ref|XP_002271957.1| PREDICTED: ribosomal RNA small subunit methy... 73 3e-11 ref|XP_003555302.1| PREDICTED: ribosomal RNA small subunit methy... 72 5e-11 ref|XP_002466524.1| hypothetical protein SORBIDRAFT_01g009310 [S... 71 8e-11 ref|XP_004136932.1| PREDICTED: ribosomal RNA small subunit methy... 71 1e-10 >emb|CBI25132.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +3 Query: 99 RGGLPRFFAQTLPSAKGDVVRVEGDEFWHITKVMRLNVNDR 221 RGGLPRFF++ LP +KG +VRV+GDEFWH+TKV+RL+VNDR Sbjct: 162 RGGLPRFFSEVLPPSKGGIVRVQGDEFWHMTKVLRLSVNDR 202 >ref|XP_002271957.1| PREDICTED: ribosomal RNA small subunit methyltransferase E-like [Vitis vinifera] Length = 287 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +3 Query: 99 RGGLPRFFAQTLPSAKGDVVRVEGDEFWHITKVMRLNVNDR 221 RGGLPRFF++ LP +KG +VRV+GDEFWH+TKV+RL+VNDR Sbjct: 39 RGGLPRFFSEVLPPSKGGIVRVQGDEFWHMTKVLRLSVNDR 79 >ref|XP_003555302.1| PREDICTED: ribosomal RNA small subunit methyltransferase E-like [Glycine max] Length = 281 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 99 RGGLPRFFAQTLPSAKGDVVRVEGDEFWHITKVMRLNVNDR 221 RGGLPRF+++TLP +KG V+RV+GDEFWH+TKV+RL NDR Sbjct: 15 RGGLPRFYSETLPPSKGSVIRVQGDEFWHMTKVLRLTTNDR 55 >ref|XP_002466524.1| hypothetical protein SORBIDRAFT_01g009310 [Sorghum bicolor] gi|241920378|gb|EER93522.1| hypothetical protein SORBIDRAFT_01g009310 [Sorghum bicolor] Length = 287 Score = 71.2 bits (173), Expect = 8e-11 Identities = 28/41 (68%), Positives = 38/41 (92%) Frame = +3 Query: 99 RGGLPRFFAQTLPSAKGDVVRVEGDEFWHITKVMRLNVNDR 221 RGGLPRF A +LPS+KG+V+R++GDEFWH+T+V+RL +NDR Sbjct: 42 RGGLPRFHAPSLPSSKGEVIRIQGDEFWHMTRVLRLGINDR 82 >ref|XP_004136932.1| PREDICTED: ribosomal RNA small subunit methyltransferase E-like [Cucumis sativus] gi|449495704|ref|XP_004159920.1| PREDICTED: ribosomal RNA small subunit methyltransferase E-like [Cucumis sativus] Length = 287 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +3 Query: 99 RGGLPRFFAQTLPSAKGDVVRVEGDEFWHITKVMRLNVNDR 221 RGGLPRFF+Q LPS KGDV+R+EGDE WH+TKV+RL +DR Sbjct: 40 RGGLPRFFSQVLPSYKGDVIRLEGDEVWHMTKVLRLKTDDR 80