BLASTX nr result
ID: Lithospermum22_contig00037051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00037051 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137561.1| PREDICTED: cation/H(+) antiporter 15-like [C... 63 2e-08 >ref|XP_004137561.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus] gi|449520557|ref|XP_004167300.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus] Length = 816 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -1 Query: 168 ICVVQKIGKSRGLFFGDNPFAYSITVLICQLTLCMFFTGCLHNLLNPLGESAFISQ 1 +C +SRG+FFGD+PF+++ T+L+ QL+L F T L LL PLGES+FISQ Sbjct: 12 VCQPTTYYRSRGIFFGDSPFSFAKTILLAQLSLSSFLTSLLQCLLTPLGESSFISQ 67