BLASTX nr result
ID: Lithospermum22_contig00036908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036908 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX51975.1| transposase [Pisum sativum] 55 3e-07 >gb|AAX51975.1| transposase [Pisum sativum] Length = 328 Score = 55.5 bits (132), Expect(2) = 3e-07 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = +1 Query: 148 GKKRVKVDHKKVNQILLRCRKSIMASSTTLGMSNSVLYRSIKHGALRRHTNVIKPQL 318 G+KRV VD +KV I L R ++ + + LG+S + L++ +K G LRRH+N +KPQ+ Sbjct: 78 GRKRVAVDIEKVRDISLAKRSTLQSLAFALGISKTALFKFVKDGTLRRHSNALKPQM 134 Score = 23.9 bits (50), Expect(2) = 3e-07 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 5 KLKYGSITKLAQTYSVSTKTISKI 76 KLK G++ LA YSVS I +I Sbjct: 36 KLKSGTVIWLASKYSVSIDVIYRI 59