BLASTX nr result
ID: Lithospermum22_contig00036558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036558 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165147.1| PREDICTED: uncharacterized protein LOC101232... 74 1e-11 ref|XP_003625593.1| hypothetical protein MTR_7g100830 [Medicago ... 69 4e-10 ref|XP_002275200.1| PREDICTED: uncharacterized protein LOC100249... 68 7e-10 emb|CAN68658.1| hypothetical protein VITISV_015697 [Vitis vinifera] 68 7e-10 ref|XP_002525170.1| hypothetical protein RCOM_0819400 [Ricinus c... 67 2e-09 >ref|XP_004165147.1| PREDICTED: uncharacterized protein LOC101232627 [Cucumis sativus] Length = 349 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +3 Query: 51 DQIQESKTEEDCINNASTPPKNAFLLTRCRSAPYRSSSLASRFWGSPLK 197 ++ +E +T E I++ S+PPKNA LLTRCRSAPYRS+SLASRFWGSPLK Sbjct: 165 EEEEEEETAEALISSNSSPPKNALLLTRCRSAPYRSTSLASRFWGSPLK 213 >ref|XP_003625593.1| hypothetical protein MTR_7g100830 [Medicago truncatula] gi|355500608|gb|AES81811.1| hypothetical protein MTR_7g100830 [Medicago truncatula] Length = 294 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 90 NNASTPPKNAFLLTRCRSAPYRSSSLASRFWGSPLK 197 +N STPPKNA LLTRCRSAPYRSSSLASRFW SPL+ Sbjct: 152 SNCSTPPKNALLLTRCRSAPYRSSSLASRFWSSPLR 187 >ref|XP_002275200.1| PREDICTED: uncharacterized protein LOC100249937 [Vitis vinifera] Length = 320 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 10/58 (17%) Frame = +3 Query: 51 DQIQESKTEEDCIN----------NASTPPKNAFLLTRCRSAPYRSSSLASRFWGSPL 194 D+++ES+ +D N ++ +PPKNA LLTRCRSAPYRSSSLASRFWGSPL Sbjct: 145 DRVEESEQSDDVGNEEEEARVFYSSSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPL 202 >emb|CAN68658.1| hypothetical protein VITISV_015697 [Vitis vinifera] Length = 743 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 10/58 (17%) Frame = +3 Query: 51 DQIQESKTEEDCIN----------NASTPPKNAFLLTRCRSAPYRSSSLASRFWGSPL 194 D+++ES+ +D N ++ +PPKNA LLTRCRSAPYRSSSLASRFWGSPL Sbjct: 569 DRVEESEQSDDVGNEEEEARVFYSSSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPL 626 >ref|XP_002525170.1| hypothetical protein RCOM_0819400 [Ricinus communis] gi|223535467|gb|EEF37136.1| hypothetical protein RCOM_0819400 [Ricinus communis] Length = 327 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +3 Query: 39 LEVVDQIQESKTEEDCINNASTPPKNAFLLTRCRSAPYRSSSLASRFWGSPL 194 +EV + +E + ++ A TPP+NA LLTR RSAPYRSSSLASRFWGSPL Sbjct: 154 VEVEEDEEEKNEAKVYVSTAITPPRNALLLTRSRSAPYRSSSLASRFWGSPL 205