BLASTX nr result
ID: Lithospermum22_contig00036423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036423 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] 51 3e-07 >emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] Length = 833 Score = 50.8 bits (120), Expect(2) = 3e-07 Identities = 20/75 (26%), Positives = 41/75 (54%) Frame = +1 Query: 76 KSNIENHKPGVLILTETKVSQSQAGEICRSLRFSNWKCADPIGCAGWVWLLWNSSEIKLD 255 K I+ H+P +++L E K+S A ++ + + FS DP G A +W+LW + +++ + Sbjct: 687 KDLIKLHEPSIVVLLEPKISGGDADQVIKEIGFSGQYHIDPEGFAHGIWILWQTEDVRAE 746 Query: 256 IIQFDSHVVNAVAEV 300 + H ++ +V Sbjct: 747 VTSSTPHQIHLSVQV 761 Score = 28.1 bits (61), Expect(2) = 3e-07 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 8 PRMVKVLAWNCRGAKNSQTISHLKVTLKTTSP 103 P K+L WNCRGA + + +K +K P Sbjct: 664 PHPKKLLCWNCRGAGELKFMRAIKDLIKLHEP 695