BLASTX nr result
ID: Lithospermum22_contig00036421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036421 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544295.1| PREDICTED: zinc finger CCCH domain-containin... 50 4e-08 gb|AAD08951.1| putative reverse transcriptase [Arabidopsis thali... 58 7e-07 gb|ABW81094.1| RT6non-ltr [Cleome spinosa] 58 9e-07 gb|AAC95175.1| putative non-LTR retroelement reverse transcripta... 53 1e-06 ref|XP_003543991.1| PREDICTED: uncharacterized protein LOC100811... 50 2e-06 >ref|XP_003544295.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like [Glycine max] Length = 1089 Score = 49.7 bits (117), Expect(2) = 4e-08 Identities = 22/50 (44%), Positives = 33/50 (66%) Frame = -1 Query: 219 KYLGVPLITARLTYADSYELSEKIVS*ISHWSTRKLSYVGRLQLVNYVLF 70 +YLG+PL + +L A L +KI+ ++HWS LSY GR+QL+ V+F Sbjct: 49 RYLGIPLTSRKLNNAQCVGLVDKILDRVNHWSAHTLSYSGRVQLLRSVIF 98 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 70 WATCLSLPKSVIRKVEKKIRSYL 2 W CL LPK VIR++E RS+L Sbjct: 104 WMQCLPLPKGVIRRIEAVCRSFL 126 >gb|AAD08951.1| putative reverse transcriptase [Arabidopsis thaliana] gi|20197043|gb|AAM14892.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 1412 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -1 Query: 219 KYLGVPLITARLTYADSYELSEKIVS*ISHWSTRKLSYVGRLQLVNYVLFGL 64 +YLG+PL+T R+T AD L EKI S IS W R LSY GRLQL+N V+ L Sbjct: 1025 RYLGLPLMTKRMTLADCLPLLEKIRSRISSWKNRFLSYAGRLQLLNSVISSL 1076 >gb|ABW81094.1| RT6non-ltr [Cleome spinosa] Length = 459 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = -1 Query: 219 KYLGVPLITARLTYADSYELSEKIVS*ISHWSTRKLSYVGRLQLVNYVLFGLL 61 KYLG+P+ T RLT AD L EKI + +S+WS++ LSY G++QLV+ V++G++ Sbjct: 134 KYLGLPVNTHRLTKADYEPLLEKIRAKVSNWSSKLLSYAGKIQLVSVVIYGMV 186 >gb|AAC95175.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1352 Score = 53.1 bits (126), Expect(2) = 1e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -1 Query: 219 KYLGVPLITARLTYADSYELSEKIVS*ISHWSTRKLSYVGRLQLVNYVL 73 KYLG+PL+T R+T +D L EKI + I+ W+ R LS+ GRLQL+ VL Sbjct: 917 KYLGLPLLTKRMTQSDYLPLVEKIRARITSWTNRFLSFAGRLQLIKSVL 965 Score = 23.9 bits (50), Expect(2) = 1e-06 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = -3 Query: 91 VSELCFVWATCLSLPKSVIRKVEKKIRSYL 2 +S + W + LPK+ ++++EK ++L Sbjct: 965 LSSITNFWLSVFRLPKACLQEIEKMFSAFL 994 >ref|XP_003543991.1| PREDICTED: uncharacterized protein LOC100811508 [Glycine max] Length = 1441 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 219 KYLGVPLITARLTYADSYELSEKIVS*ISHWSTRKLSYVGRLQLVNYV 76 +YLGVPL RLT L +KIV + HW+++ LSY GR+QLV + Sbjct: 1079 RYLGVPLSCKRLTIQQYMPLIDKIVDRVKHWTSKLLSYAGRIQLVKSI 1126 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 88 SELCFVWATCLSLPKSVIRKVEKKIRSYL 2 S + W C LP+ V+RK+ RS++ Sbjct: 1128 SAIAMYWMQCFPLPQFVLRKINAICRSFV 1156