BLASTX nr result
ID: Lithospermum22_contig00036356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036356 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513121.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002513121.1| conserved hypothetical protein [Ricinus communis] gi|223548132|gb|EEF49624.1| conserved hypothetical protein [Ricinus communis] Length = 440 Score = 57.0 bits (136), Expect = 2e-06 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 5/101 (4%) Frame = -2 Query: 289 LSPSKSPD--ANFSLEGSN---SFACDSLYKNRTSWVSRLSCSKVDNLFSESRTRVPVPD 125 L+P K P +N S SN S +S+ ++ SWVS +S SK+ NL +R RVPVP+ Sbjct: 23 LAPDKLPSRKSNDSCSTSNRLDSSLSNSVQESSFSWVSHISVSKLTNLSFVTRIRVPVPN 82 Query: 124 VKNCFPNTVSKAVSSQFYSSTAFSLPFINSTRTVDLVKGAE 2 N++ K + S A S PF+NS ++ +L KG + Sbjct: 83 TNFLVSNSIQKFPPNLLGSFIASSSPFLNSYQSAELAKGPQ 123