BLASTX nr result
ID: Lithospermum22_contig00036222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036222 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADG60257.1| IAA19-like protein [Nicotiana tabacum] 57 1e-06 ref|NP_001236733.1| uncharacterized protein LOC100305535 [Glycin... 57 1e-06 ref|XP_003528374.1| PREDICTED: auxin-induced protein AUX22-like ... 56 3e-06 ref|NP_001237849.1| auxin-induced protein AUX22 [Glycine max] gi... 56 3e-06 gb|AFZ78623.1| hypothetical protein [Populus tomentosa] 55 4e-06 >gb|ADG60257.1| IAA19-like protein [Nicotiana tabacum] Length = 175 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -3 Query: 310 PWEMFIDSCKKLKIMKGSDARGMGLQTKDLLKGIIKE 200 PWEMF +SCK+L+IMK SDA+ +G++TKD LKG+ KE Sbjct: 138 PWEMFTESCKRLRIMKRSDAKVIGIRTKDFLKGMYKE 174 >ref|NP_001236733.1| uncharacterized protein LOC100305535 [Glycine max] gi|255625835|gb|ACU13262.1| unknown [Glycine max] Length = 189 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 310 PWEMFIDSCKKLKIMKGSDARGMGLQTKDLLKGIIK 203 PWEMFI+SCK+L+IMKGSDA+G LQ K LKG I+ Sbjct: 150 PWEMFIESCKRLRIMKGSDAKGFDLQPKGSLKGFIE 185 >ref|XP_003528374.1| PREDICTED: auxin-induced protein AUX22-like [Glycine max] Length = 187 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -3 Query: 310 PWEMFIDSCKKLKIMKGSDARGMGLQTKDLLKGIIKEGS 194 PWEMF++SCK+L+IMK SDA+G GLQ K LKG I+ + Sbjct: 148 PWEMFMESCKRLRIMKRSDAKGFGLQPKGSLKGFIESAA 186 >ref|NP_001237849.1| auxin-induced protein AUX22 [Glycine max] gi|114733|sp|P13088.1|AUX22_SOYBN RecName: Full=Auxin-induced protein AUX22 gi|169919|gb|AAA33944.1| auxin-regulated protein (Aux22) [Glycine max] Length = 195 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -3 Query: 310 PWEMFIDSCKKLKIMKGSDARGMGLQTKDLLKGIIKEGS 194 PWEMF++SCK+L+IMK SDA+G GLQ K LKG I+ + Sbjct: 156 PWEMFMESCKRLRIMKKSDAKGFGLQPKGSLKGFIESAA 194 >gb|AFZ78623.1| hypothetical protein [Populus tomentosa] Length = 183 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 310 PWEMFIDSCKKLKIMKGSDARGMGLQTKDLLKGIIKE 200 PWEMF +SCK+L+IMK S+A+G GLQ + LKGI K+ Sbjct: 144 PWEMFFESCKRLRIMKSSEAKGFGLQPRGALKGISKD 180