BLASTX nr result
ID: Lithospermum22_contig00036138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00036138 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543991.1| PREDICTED: uncharacterized protein LOC100811... 56 4e-06 ref|XP_003533176.1| PREDICTED: uncharacterized protein LOC100777... 56 4e-06 emb|CAB45965.1| putative reverse transcriptase [Arabidopsis thal... 55 8e-06 >ref|XP_003543991.1| PREDICTED: uncharacterized protein LOC100811508 [Glycine max] Length = 1441 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/54 (42%), Positives = 33/54 (61%) Frame = +3 Query: 213 VVWKYVCREKIEGDLGIRRLHD*NTTSMVYHVWNLCSRKETLWV*WINSYRLKG 374 V W +CR K +G +GI L N S++ +WN+C E LWV W+++Y LKG Sbjct: 1169 VAWDTMCRNKSQGGVGIINLQVWNIVSLMKCLWNICRNSENLWVLWVHTYYLKG 1222 >ref|XP_003533176.1| PREDICTED: uncharacterized protein LOC100777167 [Glycine max] Length = 1324 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/54 (42%), Positives = 33/54 (61%) Frame = +3 Query: 213 VVWKYVCREKIEGDLGIRRLHD*NTTSMVYHVWNLCSRKETLWV*WINSYRLKG 374 V W +CR K +G +GI L N S++ +WN+C E LWV W+++Y LKG Sbjct: 1052 VAWDTMCRNKSQGGVGIINLQVWNIVSLMKCLWNICRNSENLWVMWVHTYYLKG 1105 >emb|CAB45965.1| putative reverse transcriptase [Arabidopsis thaliana] gi|7267919|emb|CAB78261.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 662 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = +3 Query: 180 SKP*RSLFNAKVVWKYVCREKIEGDLGIRRLHD*NTTSMVYHVWNLCSRKETLWV*WINS 359 S P S AK+ W+ VCR K EG LG++ + + N + +W + S+ ++LWV WI + Sbjct: 367 SGPELSTNKAKIAWETVCRPKREGGLGLQSIKEANDVCCLKLIWRIVSQGDSLWVQWIRT 426 Query: 360 YRLK 371 Y LK Sbjct: 427 YLLK 430