BLASTX nr result
ID: Lithospermum22_contig00035886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035886 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529053.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002529053.1| conserved hypothetical protein [Ricinus communis] gi|223531533|gb|EEF33364.1| conserved hypothetical protein [Ricinus communis] Length = 508 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +1 Query: 202 LNTKLEVASSHSNAKILKSNRRTKHGRQLSMYDTDDDEEED 324 +++KL V S+HSNAKILKSNR+++ G+ LS Y +DDDEEE+ Sbjct: 47 VSSKLVVLSTHSNAKILKSNRKSRFGQTLSPYASDDDEEEE 87