BLASTX nr result
ID: Lithospermum22_contig00035637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035637 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527996.1| Cation transport protein chaC, putative [Ric... 55 6e-06 >ref|XP_002527996.1| Cation transport protein chaC, putative [Ricinus communis] gi|223532622|gb|EEF34408.1| Cation transport protein chaC, putative [Ricinus communis] Length = 223 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = -3 Query: 439 IIELANEVRKVLGIDGIKAPQEKRLTSPSHSPLKSAHISPLSVHPLVEAVATDS 278 +IELANEVRKVLGI G P+EK+L PSH LKS ++ L + L EAVA DS Sbjct: 171 VIELANEVRKVLGIVGKGIPKEKKLAGPSHIALKS-NMPALQLRLLPEAVALDS 223