BLASTX nr result
ID: Lithospermum22_contig00035622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035622 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_179197.1| pentatricopeptide repeat-containing protein [Ar... 98 8e-19 ref|XP_002306075.1| predicted protein [Populus trichocarpa] gi|2... 94 9e-18 ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containi... 88 6e-16 ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_002519113.1| pentatricopeptide repeat-containing protein,... 80 2e-13 >ref|NP_179197.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75267579|sp|Q9XIM8.1|PP155_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15980 gi|5306237|gb|AAD41970.1| hypothetical protein [Arabidopsis thaliana] gi|330251359|gb|AEC06453.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 498 Score = 97.8 bits (242), Expect = 8e-19 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = +2 Query: 140 SPPELNDPIITNSVSILKHHRSKSRWSHLRTTTPPTGFTPSQVSQITLQLRNSPHLAFRF 319 SPP +DP+I+++VSIL HHRSKSRWS LR+ P +GFTPSQ S+ITL LRN+PHL+ RF Sbjct: 35 SPP--SDPLISDAVSILTHHRSKSRWSTLRSLQP-SGFTPSQFSEITLCLRNNPHLSLRF 91 Query: 320 FHFTLQHSLCDHTISTYATII 382 F FT ++SLC H + +T+I Sbjct: 92 FLFTRRYSLCSHDTHSCSTLI 112 >ref|XP_002306075.1| predicted protein [Populus trichocarpa] gi|222849039|gb|EEE86586.1| predicted protein [Populus trichocarpa] Length = 498 Score = 94.4 bits (233), Expect = 9e-18 Identities = 47/84 (55%), Positives = 58/84 (69%), Gaps = 4/84 (4%) Frame = +2 Query: 143 PPELNDPIITNSVSILKHHRSKSRWSHLR---TTTPPTGFTPSQVSQITLQLRNSPHLAF 313 PP + P+ T +S+L HHRSKSRWSHLR TTT T P S ITL+L+++PHLA Sbjct: 32 PPNHHSPLTTAIISLLTHHRSKSRWSHLRSLLTTTTSTPLAPGHFSLITLKLKSNPHLAL 91 Query: 314 RFFHFTLQH-SLCDHTISTYATII 382 FFHFTL + SLC H + +YATII Sbjct: 92 SFFHFTLHNSSLCSHNLRSYATII 115 >ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Vitis vinifera] Length = 492 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/73 (56%), Positives = 57/73 (78%) Frame = +2 Query: 164 IITNSVSILKHHRSKSRWSHLRTTTPPTGFTPSQVSQITLQLRNSPHLAFRFFHFTLQHS 343 +I+ +VSIL+H RSKSRWSHL++ P GFTP++ SQI LQ++N+PHLA FF + S Sbjct: 36 LISTAVSILRHQRSKSRWSHLQSLFPK-GFTPTEASQIVLQIKNNPHLALSFFLWCHHKS 94 Query: 344 LCDHTISTYATII 382 LC+HT+ +Y+TII Sbjct: 95 LCNHTLLSYSTII 107 >ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Glycine max] Length = 487 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/78 (50%), Positives = 59/78 (75%) Frame = +2 Query: 149 ELNDPIITNSVSILKHHRSKSRWSHLRTTTPPTGFTPSQVSQITLQLRNSPHLAFRFFHF 328 + + ++T++VSIL HHRSKSRWS+LR+ P G TP++ S+ITL ++N P LA RFF + Sbjct: 29 DASQSLVTDAVSILTHHRSKSRWSNLRSACP-NGITPAEFSEITLHIKNKPQLALRFFLW 87 Query: 329 TLQHSLCDHTISTYATII 382 T SLC+H +++Y++II Sbjct: 88 TKSKSLCNHNLASYSSII 105 >ref|XP_002519113.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541776|gb|EEF43324.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 80.1 bits (196), Expect = 2e-13 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 3/83 (3%) Frame = +2 Query: 140 SPPELNDPIITNSVSILKHHRSKSRWSHLRT--TTPPTGFTPSQVSQITLQLRNSPHLAF 313 SPP + +IT S+L HHRSKSRW+HLR+ T TP+ SQI L L+++P LA Sbjct: 26 SPPSSDQQLITTITSLLIHHRSKSRWTHLRSLILTSNKTLTPTHFSQIILLLKSNPRLAL 85 Query: 314 RFFHFTLQH-SLCDHTISTYATI 379 RFFHFTL++ S C H + + +TI Sbjct: 86 RFFHFTLRNPSFCSHDLRSISTI 108