BLASTX nr result
ID: Lithospermum22_contig00035588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035588 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598835.1| Cellular nucleic acid-binding protein [Medic... 57 2e-06 ref|XP_003600156.1| Cellular nucleic acid-binding protein [Medic... 55 6e-06 >ref|XP_003598835.1| Cellular nucleic acid-binding protein [Medicago truncatula] gi|355487883|gb|AES69086.1| Cellular nucleic acid-binding protein [Medicago truncatula] Length = 225 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 125 CFRCGRTNHRIQGCRQREVICYRCRQLGHIATNCSQFQATSSGTDAFTL 271 CF+CGRT H + CR + V+CY + GHI+T C + + SG + F L Sbjct: 165 CFKCGRTGHNAEECRSKNVVCYNYGESGHISTKCQKAKKAQSGGNVFAL 213 >ref|XP_003600156.1| Cellular nucleic acid-binding protein [Medicago truncatula] gi|355489204|gb|AES70407.1| Cellular nucleic acid-binding protein [Medicago truncatula] Length = 651 Score = 55.1 bits (131), Expect = 6e-06 Identities = 20/49 (40%), Positives = 31/49 (63%) Frame = +2 Query: 125 CFRCGRTNHRIQGCRQREVICYRCRQLGHIATNCSQFQATSSGTDAFTL 271 CFRCG+ H + C++ +V+CY C + GHI+T C+Q + +G F L Sbjct: 368 CFRCGQKGHVLADCKRGDVVCYNCNEEGHISTQCTQPKKVRTGGKVFAL 416