BLASTX nr result
ID: Lithospermum22_contig00035533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035533 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 88 6e-16 gb|AAD24600.1| putative retroelement pol polyprotein [Arabidopsi... 84 1e-14 emb|CAA18107.1| LTR retrotransposon like protein [Arabidopsis th... 82 4e-14 gb|AAG50751.1|AC079733_19 polyprotein, putative [Arabidopsis tha... 82 4e-14 dbj|BAB10743.1| retroelement pol polyprotein-like [Arabidopsis t... 82 6e-14 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 88.2 bits (217), Expect = 6e-16 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -3 Query: 182 ILNVARALRFQGNLPISFWGESILTAGFLINRTPSSVLHFNTPYELIYEGSPVYSELGVF 3 ILNVARAL FQ +LPI FWGESILTA +LINRTPSS+L TPYE+++ PVYS+L VF Sbjct: 693 ILNVARALLFQASLPIKFWGESILTAAYLINRTPSSILSGRTPYEVLHGSKPVYSQLRVF 752 >gb|AAD24600.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1333 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/60 (65%), Positives = 48/60 (80%) Frame = -3 Query: 182 ILNVARALRFQGNLPISFWGESILTAGFLINRTPSSVLHFNTPYELIYEGSPVYSELGVF 3 +LNVARALRFQ NLPI FWGE +LTA +LINRTPSSVL+ +TPYE +++ P + L VF Sbjct: 556 LLNVARALRFQANLPIQFWGECVLTAAYLINRTPSSVLNDSTPYERLHKKQPRFDHLRVF 615 >emb|CAA18107.1| LTR retrotransposon like protein [Arabidopsis thaliana] gi|7269049|emb|CAB79159.1| LTR retrotransposon like protein [Arabidopsis thaliana] Length = 1109 Score = 82.0 bits (201), Expect = 4e-14 Identities = 38/60 (63%), Positives = 47/60 (78%) Frame = -3 Query: 182 ILNVARALRFQGNLPISFWGESILTAGFLINRTPSSVLHFNTPYELIYEGSPVYSELGVF 3 ILN+ARALRFQ LPI FWGE IL+A +LINRTPS +L +PYE++Y+ +P YS L VF Sbjct: 456 ILNIARALRFQSYLPIQFWGECILSAAYLINRTPSMLLQGKSPYEMLYKTAPKYSHLRVF 515 >gb|AAG50751.1|AC079733_19 polyprotein, putative [Arabidopsis thaliana] Length = 1468 Score = 82.0 bits (201), Expect = 4e-14 Identities = 38/60 (63%), Positives = 47/60 (78%) Frame = -3 Query: 182 ILNVARALRFQGNLPISFWGESILTAGFLINRTPSSVLHFNTPYELIYEGSPVYSELGVF 3 ILN+ARALRFQ LPI FWGE IL+A +LINRTPS +L +PYE++Y+ +P YS L VF Sbjct: 680 ILNIARALRFQSYLPIQFWGECILSAAYLINRTPSMLLQGKSPYEMLYKTAPKYSHLRVF 739 >dbj|BAB10743.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 1109 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/60 (63%), Positives = 47/60 (78%) Frame = -3 Query: 182 ILNVARALRFQGNLPISFWGESILTAGFLINRTPSSVLHFNTPYELIYEGSPVYSELGVF 3 ILN+ARALRFQ LPI FWGE IL+A +LINRTPS +L +PYE++Y+ +P YS L VF Sbjct: 456 ILNIARALRFQSYLPIQFWGECILSAAYLINRTPSMLLQGKSPYEMLYKTAPNYSHLRVF 515