BLASTX nr result
ID: Lithospermum22_contig00035462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035462 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307286.1| predicted protein [Populus trichocarpa] gi|2... 55 1e-06 ref|XP_002278529.1| PREDICTED: probable LRR receptor-like serine... 55 6e-06 emb|CAN59805.1| hypothetical protein VITISV_038877 [Vitis vinifera] 55 6e-06 ref|XP_003550036.1| PREDICTED: probable LRR receptor-like serine... 55 8e-06 >ref|XP_002307286.1| predicted protein [Populus trichocarpa] gi|222856735|gb|EEE94282.1| predicted protein [Populus trichocarpa] Length = 773 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 112 QTYGLNLDGVLLLSFKFNILHDPLEKLVNWNIQDETP 2 Q++GLN DGVLLLSFK++IL DPL L +WN D+TP Sbjct: 25 QSFGLNTDGVLLLSFKYSILDDPLSVLQSWNHSDQTP 61 Score = 22.7 bits (47), Expect(2) = 1e-06 Identities = 6/13 (46%), Positives = 12/13 (92%) Frame = -2 Query: 167 IYLWWKILSITLL 129 ++LWW+IL++ +L Sbjct: 8 LHLWWRILALGIL 20 >ref|XP_002278529.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g37250-like [Vitis vinifera] Length = 781 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = -3 Query: 148 FFQLLCFFITSHQTYGLNLDGVLLLSFKFNILHDPLEKLVNWNIQDETP 2 ++++L F + Q++G+N DG+LLLS K+++L DPL L +WN DETP Sbjct: 11 WWRILSFVLLLVQSFGINRDGILLLSLKYSVLSDPLSALESWNHYDETP 59 >emb|CAN59805.1| hypothetical protein VITISV_038877 [Vitis vinifera] Length = 752 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = -3 Query: 148 FFQLLCFFITSHQTYGLNLDGVLLLSFKFNILHDPLEKLVNWNIQDETP 2 ++++L F + Q++G+N DG+LLLS K+++L DPL L +WN DETP Sbjct: 11 WWRILSFVLLLVQSFGINRDGILLLSLKYSVLSDPLSALESWNHYDETP 59 >ref|XP_003550036.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g37250-like [Glycine max] Length = 761 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 139 LLCFFITSHQTYGLNLDGVLLLSFKFNILHDPLEKLVNWNIQDETP 2 L+ +T +Q L+ DGVLLLSFK+ +L+DPL L NWN DETP Sbjct: 12 LVILLVTVNQCCALSRDGVLLLSFKYAVLNDPLYVLANWNYSDETP 57