BLASTX nr result
ID: Lithospermum22_contig00035446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035446 (649 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD21778.1| putative non-LTR retroelement reverse transcripta... 61 4e-10 ref|XP_003621614.1| DNA-directed RNA polymerase III subunit RPC6... 68 1e-09 gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-... 56 2e-09 gb|AAD32950.1| putative non-LTR retroelement reverse transcripta... 56 2e-09 gb|ADK92871.1| retrotransposon protein [Hypericum perforatum] 54 1e-08 >gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1715 Score = 60.8 bits (146), Expect(2) = 4e-10 Identities = 23/52 (44%), Positives = 35/52 (67%) Frame = -3 Query: 350 KQVWKLRLPPRVKQFLWRCLHNIVPTKERRRRRGIMVDPTCILCNNAAETLN 195 +++W+L++ P++K F+WRCL + T + R R I DPTC C NA ET+N Sbjct: 1386 QEIWRLKITPKIKHFIWRCLSGALSTTTQLRNRNIPADPTCQRCCNADETIN 1437 Score = 28.9 bits (63), Expect(2) = 4e-10 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 538 EKVLEGEDVRRVLGILLSRRGVRNKLSWSHTRCGNYLTSLGYKYARPMQRIEGRV 374 E VL ED + + LS R+ W++TR Y GY A + E + Sbjct: 1320 EGVLNPEDQQLAKSLYLSNYAARDSYKWAYTRNTQYTVRSGYWVATHVNLTEEEI 1374 >ref|XP_003621614.1| DNA-directed RNA polymerase III subunit RPC6 [Medicago truncatula] gi|355496629|gb|AES77832.1| DNA-directed RNA polymerase III subunit RPC6 [Medicago truncatula] Length = 456 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/93 (38%), Positives = 50/93 (53%), Gaps = 7/93 (7%) Frame = -3 Query: 353 WKQVWKLRLPPRVKQFLWRCLHNIVPTKERRRRRGIMVDPTCILCNNAAETLNTFTT*LP 174 WK +WKL LP RV+ F+W+ NI+PT+ RRRG+++D C LC +A E+ N P Sbjct: 260 WKLIWKLPLPTRVRNFMWKLARNIIPTRCNLRRRGVVLDTVCPLCFDADESSNHRFMACP 319 Query: 173 IYFQVMAYLPTHFE-------NLWRALAILYWL 96 + QV P F+ N W +L WL Sbjct: 320 MTLQVWFASPLGFQPPPQTDLNAW----LLSWL 348 >gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana] Length = 1142 Score = 55.8 bits (133), Expect(2) = 2e-09 Identities = 20/50 (40%), Positives = 33/50 (66%) Frame = -3 Query: 344 VWKLRLPPRVKQFLWRCLHNIVPTKERRRRRGIMVDPTCILCNNAAETLN 195 +WK++ PP+++ FLW+ L VP E R+RGI+ D C+ C + E++N Sbjct: 828 IWKVQCPPKLRHFLWQILSGCVPVSENLRKRGILCDKGCVSCGASEESIN 877 Score = 32.0 bits (71), Expect(2) = 2e-09 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -1 Query: 541 VEKVLEGEDVRRVLGILLSRRGVRNKLSWSHTRCGNYLTSLGYKYAR 401 ++++ + EDV + + + + + L W T+ GNY GY AR Sbjct: 761 LKELFDPEDVPLISALPIGNPNMEDTLGWHFTKAGNYTVKSGYHTAR 807 >gb|AAD32950.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 773 Score = 55.8 bits (133), Expect(2) = 2e-09 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = -3 Query: 368 STSGTWKQVWKLRLPPRVKQFLWRCLHNIVPTKERRRRRGIMVDPTCILCNNAAETLN 195 S + +WK PP++K F WR HN +PT +RR ++ D TC C A+E +N Sbjct: 493 SAQTVFTNIWKQNAPPKIKHFWWRSAHNALPTAGNLKRRRLITDDTCQRCGEASEDVN 550 Score = 32.0 bits (71), Expect(2) = 2e-09 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -1 Query: 562 GQ*NQGEVEKVLEGEDVRRVLGILLSRRGVRNKLSWSHTRCGNYLTSLGYKYARPMQR 389 G+ N+ + K++ D+ + I S G + ++W +T GNY GY R + + Sbjct: 423 GRWNEDLLCKLIHQNDIPHIRAIRPSITGANDAITWIYTHDGNYSVKSGYHLLRKLSQ 480 >gb|ADK92871.1| retrotransposon protein [Hypericum perforatum] Length = 593 Score = 54.3 bits (129), Expect(2) = 1e-08 Identities = 23/51 (45%), Positives = 28/51 (54%) Frame = -3 Query: 353 WKQVWKLRLPPRVKQFLWRCLHNIVPTKERRRRRGIMVDPTCILCNNAAET 201 WK W LR PPR+K LWR + N + + RRGI VD C C +ET Sbjct: 281 WKTCWGLRCPPRIKTLLWRLIDNNLSVRTNLTRRGIQVDEVCPCCAGPSET 331 Score = 30.4 bits (67), Expect(2) = 1e-08 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 553 NQGEVEKVLEGEDVRRVLGILLSRRGVRNKLSWSHTRCGNYLTSLGY 413 N+ + E EDV R+L I LS R + + W + G Y GY Sbjct: 211 NENLLRLCFEEEDVTRILQIRLSLRRPLDMVRWKFIKDGEYTVRSGY 257