BLASTX nr result
ID: Lithospermum22_contig00035320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035320 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527667.1| ring finger protein, putative [Ricinus commu... 57 2e-06 >ref|XP_002527667.1| ring finger protein, putative [Ricinus communis] gi|223532972|gb|EEF34738.1| ring finger protein, putative [Ricinus communis] Length = 383 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 2 SCIDVWLKSHSNCPLCRANIAFVNCEIIEIPP 97 SCID WLKSHSNCPLCRANI F++ + +PP Sbjct: 175 SCIDTWLKSHSNCPLCRANIIFISASLPPLPP 206