BLASTX nr result
ID: Lithospermum22_contig00035295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035295 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526391.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003588474.1| Pentatricopeptide repeat-containing protein ... 55 8e-06 >ref|XP_003526391.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Glycine max] Length = 647 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = -3 Query: 168 VVEDKDLLKKTPNGK--LQVLELIDEGRLYPNGSLYNKLIKMCTQLKRLPEGKMVH 7 V++D++LL+ + N K L VL+LID G L P+ +LYN L+K CTQL +L EGK+VH Sbjct: 42 VIDDRNLLRPSLNSKTGLHVLDLIDCGSLEPDRTLYNTLLKRCTQLGKLKEGKLVH 97 >ref|XP_003588474.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477522|gb|AES58725.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 668 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 4/59 (6%) Frame = -3 Query: 168 VVEDKDLLKKTPNGK----LQVLELIDEGRLYPNGSLYNKLIKMCTQLKRLPEGKMVHT 4 +++D +LL+ + N L VL+LI+ G L P+ ++YNKL+K CT L +L +GK+VHT Sbjct: 57 IIDDTNLLRPSLNPNSTTGLHVLDLINNGSLEPDRTIYNKLLKRCTMLGKLKQGKLVHT 115