BLASTX nr result
ID: Lithospermum22_contig00035248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035248 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281028.1| PREDICTED: heat stress transcription factor ... 94 9e-18 ref|XP_002514309.1| DNA binding protein, putative [Ricinus commu... 88 6e-16 ref|NP_189095.1| heat stress transcription factor C-1 [Arabidops... 88 8e-16 gb|AEK67477.1| heat shock factor [Arabidopsis thaliana] 88 8e-16 gb|ADL36734.1| HSF domain class transcription factor [Malus x do... 88 8e-16 >ref|XP_002281028.1| PREDICTED: heat stress transcription factor C-1 [Vitis vinifera] gi|147779536|emb|CAN72162.1| hypothetical protein VITISV_009631 [Vitis vinifera] gi|297738829|emb|CBI28074.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 94.4 bits (233), Expect = 9e-18 Identities = 41/52 (78%), Positives = 49/52 (94%) Frame = +3 Query: 189 IAPFVIKTYQMVNDSSTNGIISWGRANNSFIILEPLDFSKLILPSYFKHNNF 344 IAPFV+KTYQMVNDSST+ +I+WGRANNSFI+ +PLDFS+ ILP+YFKHNNF Sbjct: 9 IAPFVMKTYQMVNDSSTDALITWGRANNSFIVFDPLDFSQRILPAYFKHNNF 60 >ref|XP_002514309.1| DNA binding protein, putative [Ricinus communis] gi|223546765|gb|EEF48263.1| DNA binding protein, putative [Ricinus communis] Length = 337 Score = 88.2 bits (217), Expect = 6e-16 Identities = 37/52 (71%), Positives = 49/52 (94%) Frame = +3 Query: 189 IAPFVIKTYQMVNDSSTNGIISWGRANNSFIILEPLDFSKLILPSYFKHNNF 344 IAPFV+KTYQ+VND +T+ +I+WG+ANNSFI+++PLDFS+ ILP+YFKHNNF Sbjct: 10 IAPFVMKTYQIVNDPTTDTLITWGKANNSFIVVDPLDFSQRILPAYFKHNNF 61 >ref|NP_189095.1| heat stress transcription factor C-1 [Arabidopsis thaliana] gi|75311616|sp|Q9LV52.1|HSFC1_ARATH RecName: Full=Heat stress transcription factor C-1; Short=AtHsfC1; AltName: Full=AtHsf-08 gi|9294046|dbj|BAB02003.1| unnamed protein product [Arabidopsis thaliana] gi|15810194|gb|AAL06998.1| AT3g24520/MOB24_5 [Arabidopsis thaliana] gi|18252249|gb|AAL62005.1| AT3g24520/MOB24_5 [Arabidopsis thaliana] gi|332643394|gb|AEE76915.1| heat stress transcription factor C-1 [Arabidopsis thaliana] Length = 330 Score = 87.8 bits (216), Expect = 8e-16 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +3 Query: 189 IAPFVIKTYQMVNDSSTNGIISWGRANNSFIILEPLDFSKLILPSYFKHNNF 344 IAPF++KTYQMVND ST+ +I+WG A+NSFI+++PLDFS+ ILP+YFKHNNF Sbjct: 15 IAPFIVKTYQMVNDPSTDWLITWGPAHNSFIVVDPLDFSQRILPAYFKHNNF 66 >gb|AEK67477.1| heat shock factor [Arabidopsis thaliana] Length = 329 Score = 87.8 bits (216), Expect = 8e-16 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +3 Query: 189 IAPFVIKTYQMVNDSSTNGIISWGRANNSFIILEPLDFSKLILPSYFKHNNF 344 IAPF++KTYQMVND ST+ +I+WG A+NSFI+++PLDFS+ ILP+YFKHNNF Sbjct: 15 IAPFIVKTYQMVNDPSTDWLITWGPAHNSFIVVDPLDFSQRILPAYFKHNNF 66 >gb|ADL36734.1| HSF domain class transcription factor [Malus x domestica] Length = 339 Score = 87.8 bits (216), Expect = 8e-16 Identities = 36/52 (69%), Positives = 49/52 (94%) Frame = +3 Query: 189 IAPFVIKTYQMVNDSSTNGIISWGRANNSFIILEPLDFSKLILPSYFKHNNF 344 IAPFV+KTYQMVNDS+T+ +I+WGRANNSF++++P+ FS+ +LP+YFKHNNF Sbjct: 10 IAPFVMKTYQMVNDSTTDNLITWGRANNSFVVVDPVVFSQRLLPAYFKHNNF 61