BLASTX nr result
ID: Lithospermum22_contig00035167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035167 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145561.1| PREDICTED: cyclin-dependent kinase B2-2-like... 168 5e-40 gb|ABN58480.1| cyclin-dependent kinase [Actinidia chinensis] 167 8e-40 sp|Q38775.1|CDC2D_ANTMA RecName: Full=Cell division control prot... 166 1e-39 ref|NP_173517.1| cyclin-dependent kinase B2-2 [Arabidopsis thali... 166 2e-39 gb|AFK45757.1| unknown [Medicago truncatula] 166 2e-39 >ref|XP_004145561.1| PREDICTED: cyclin-dependent kinase B2-2-like [Cucumis sativus] gi|449531219|ref|XP_004172585.1| PREDICTED: cyclin-dependent kinase B2-2-like [Cucumis sativus] Length = 312 Score = 168 bits (425), Expect = 5e-40 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = +3 Query: 3 YQLCKGVAFCHSHGVLHRDLKPHNLLMDTKTMMLKIADLGLARAYTVPMKKYTHEILTLW 182 YQLCKGVAFCH HG+LHRDLKPHNLLMD KTMMLKIADLGLARA+TVP+KKYTHEILTLW Sbjct: 127 YQLCKGVAFCHGHGILHRDLKPHNLLMDRKTMMLKIADLGLARAFTVPIKKYTHEILTLW 186 Query: 183 YRAPEVLLGATHYSTGVDMWSVA 251 YRAPEVLLGATHYST VDMWSVA Sbjct: 187 YRAPEVLLGATHYSTAVDMWSVA 209 >gb|ABN58480.1| cyclin-dependent kinase [Actinidia chinensis] Length = 302 Score = 167 bits (423), Expect = 8e-40 Identities = 77/82 (93%), Positives = 79/82 (96%) Frame = +3 Query: 3 YQLCKGVAFCHSHGVLHRDLKPHNLLMDTKTMMLKIADLGLARAYTVPMKKYTHEILTLW 182 YQLCKGVAFCH HGVLHRDLKPHNLLMD KTMMLKIADLGLARAYT+P+KKYTHEILTLW Sbjct: 117 YQLCKGVAFCHGHGVLHRDLKPHNLLMDRKTMMLKIADLGLARAYTLPIKKYTHEILTLW 176 Query: 183 YRAPEVLLGATHYSTGVDMWSV 248 YRAPEVLLGATHYST VDMWSV Sbjct: 177 YRAPEVLLGATHYSTAVDMWSV 198 >sp|Q38775.1|CDC2D_ANTMA RecName: Full=Cell division control protein 2 homolog D gi|1321678|emb|CAA66236.1| cyclin-dependent kinase [Antirrhinum majus] Length = 312 Score = 166 bits (421), Expect = 1e-39 Identities = 77/83 (92%), Positives = 79/83 (95%) Frame = +3 Query: 3 YQLCKGVAFCHSHGVLHRDLKPHNLLMDTKTMMLKIADLGLARAYTVPMKKYTHEILTLW 182 YQLCKGVAFCH HGVLHRDLKPHNLLMD KTMMLKIADLGLARAYT+P+KKYTHEILTLW Sbjct: 127 YQLCKGVAFCHGHGVLHRDLKPHNLLMDRKTMMLKIADLGLARAYTLPIKKYTHEILTLW 186 Query: 183 YRAPEVLLGATHYSTGVDMWSVA 251 YRAPEVLLGATHYS VDMWSVA Sbjct: 187 YRAPEVLLGATHYSPAVDMWSVA 209 >ref|NP_173517.1| cyclin-dependent kinase B2-2 [Arabidopsis thaliana] gi|152013425|sp|Q8LG64.2|CKB22_ARATH RecName: Full=Cyclin-dependent kinase B2-2; Short=CDKB2;2 gi|4836894|gb|AAD30597.1|AC007369_7 Putative cdc2 kinase [Arabidopsis thaliana] gi|89001057|gb|ABD59118.1| At1g20930 [Arabidopsis thaliana] gi|110738782|dbj|BAF01314.1| putative cell division control protein [Arabidopsis thaliana] gi|332191922|gb|AEE30043.1| cyclin-dependent kinase B2-2 [Arabidopsis thaliana] Length = 315 Score = 166 bits (420), Expect = 2e-39 Identities = 76/82 (92%), Positives = 79/82 (96%) Frame = +3 Query: 3 YQLCKGVAFCHSHGVLHRDLKPHNLLMDTKTMMLKIADLGLARAYTVPMKKYTHEILTLW 182 YQLCKG+AFCH HGVLHRDLKPHNLLMD KTM LKIADLGLARA+T+PMKKYTHEILTLW Sbjct: 129 YQLCKGMAFCHGHGVLHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLW 188 Query: 183 YRAPEVLLGATHYSTGVDMWSV 248 YRAPEVLLGATHYSTGVDMWSV Sbjct: 189 YRAPEVLLGATHYSTGVDMWSV 210 >gb|AFK45757.1| unknown [Medicago truncatula] Length = 316 Score = 166 bits (420), Expect = 2e-39 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = +3 Query: 3 YQLCKGVAFCHSHGVLHRDLKPHNLLMDTKTMMLKIADLGLARAYTVPMKKYTHEILTLW 182 YQLCKGVAFCH HG+LHRDLKPHNLLMD KTMMLKIADLGLARA+TVP+KKYTHEILTLW Sbjct: 131 YQLCKGVAFCHGHGILHRDLKPHNLLMDRKTMMLKIADLGLARAFTVPLKKYTHEILTLW 190 Query: 183 YRAPEVLLGATHYSTGVDMWSVA 251 YRAPEVLLGATHYS VDMWSVA Sbjct: 191 YRAPEVLLGATHYSMAVDMWSVA 213