BLASTX nr result
ID: Lithospermum22_contig00034856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034856 (741 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318969.1| predicted protein [Populus trichocarpa] gi|2... 56 7e-06 >ref|XP_002318969.1| predicted protein [Populus trichocarpa] gi|222857345|gb|EEE94892.1| predicted protein [Populus trichocarpa] Length = 981 Score = 56.2 bits (134), Expect = 7e-06 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 4/83 (4%) Frame = -2 Query: 470 EPECVLQTKLRRLSSLPN-GVGSGITAKKTGLKLSNGLDKRGLIPT---PPRRRISNGIS 303 EP+ + Q+ + R+SSLPN V T K T + + R LIP+ P R++ NG S Sbjct: 899 EPDLLWQSNIPRMSSLPNPNVLGSKTKKTTNPRGFKSTETRSLIPSLIPSPSRKLPNGAS 958 Query: 302 PLSQKTGRSPASLDGKRKPVHAK 234 P K GR S+DGKRK HAK Sbjct: 959 PGLNKPGRQLVSVDGKRKTGHAK 981