BLASTX nr result
ID: Lithospermum22_contig00034685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034685 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277764.1| PREDICTED: cation/H(+) antiporter 24 [Vitis ... 65 4e-09 emb|CAN64281.1| hypothetical protein VITISV_028835 [Vitis vinifera] 65 4e-09 ref|XP_004145306.1| PREDICTED: cation/H(+) antiporter 25-like [C... 62 5e-08 ref|XP_002516341.1| monovalent cation:proton antiporter, putativ... 59 4e-07 ref|XP_003617152.1| K(+)/H(+) antiporter [Medicago truncatula] g... 58 9e-07 >ref|XP_002277764.1| PREDICTED: cation/H(+) antiporter 24 [Vitis vinifera] gi|297745818|emb|CBI15874.3| unnamed protein product [Vitis vinifera] Length = 783 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 276 LYGLSNWSHNRELGAVGDYVASPDLGSSGSVLVVQQQILRGQHL 145 L GLSNWS N+ELG +GDY+AS D S+ SVLV+QQQ+LRGQ + Sbjct: 733 LEGLSNWSENQELGVIGDYIASMDFSSTASVLVLQQQVLRGQRM 776 >emb|CAN64281.1| hypothetical protein VITISV_028835 [Vitis vinifera] Length = 746 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 276 LYGLSNWSHNRELGAVGDYVASPDLGSSGSVLVVQQQILRGQHL 145 L GLSNWS N+ELG +GDY+AS D S+ SVLV+QQQ+LRGQ + Sbjct: 696 LEGLSNWSENQELGVIGDYIASMDFSSTASVLVLQQQVLRGQRM 739 >ref|XP_004145306.1| PREDICTED: cation/H(+) antiporter 25-like [Cucumis sativus] gi|449472766|ref|XP_004153689.1| PREDICTED: cation/H(+) antiporter 25-like [Cucumis sativus] gi|449523407|ref|XP_004168715.1| PREDICTED: cation/H(+) antiporter 25-like [Cucumis sativus] Length = 598 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -2 Query: 276 LYGLSNWSHNRELGAVGDYVASPDLGSSGSVLVVQQQILRGQHLAGKKFFNRLRF 112 L GLSNWSH ELG VGD+VAS D ++ SVLV+QQQILR Q ++RF Sbjct: 541 LEGLSNWSHQNELGIVGDFVASEDFTAASSVLVLQQQILRDQGQFSSGICGKIRF 595 >ref|XP_002516341.1| monovalent cation:proton antiporter, putative [Ricinus communis] gi|223544507|gb|EEF46025.1| monovalent cation:proton antiporter, putative [Ricinus communis] Length = 377 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 276 LYGLSNWSHNRELGAVGDYVASPDLGSSGSVLVVQQQILRGQ 151 L GLSNWS N ELG +GDY+AS D GS+ SVLV+ QQI+R Q Sbjct: 330 LDGLSNWSENLELGVIGDYIASFDFGSAASVLVMHQQIMRVQ 371 >ref|XP_003617152.1| K(+)/H(+) antiporter [Medicago truncatula] gi|355518487|gb|AET00111.1| K(+)/H(+) antiporter [Medicago truncatula] Length = 801 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 270 GLSNWSHNRELGAVGDYVASPDLGSSGSVLVVQQQILRGQHLAG 139 GL+ WS ELGA+GD++ASPDL SS SVLVVQQQ+ R L G Sbjct: 755 GLAEWSEFPELGAIGDFLASPDLNSSASVLVVQQQLSRTNDLKG 798