BLASTX nr result
ID: Lithospermum22_contig00034473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034473 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein ... 68 1e-09 ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein ... 68 1e-09 ref|XP_003589652.1| hypothetical protein MTR_1g031590 [Medicago ... 67 2e-09 ref|XP_002311505.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein ... 67 2e-09 >ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 RQMLSIRARSDLKGIELKRPNDSIYSFPCPDCMC 102 RQ+LS+R+ SD KG+ELKRPNDSIYSFPCPDCMC Sbjct: 517 RQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMC 550 >ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 RQMLSIRARSDLKGIELKRPNDSIYSFPCPDCMC 102 RQ+LS+R+ SD KG+ELKRPNDSIYSFPCPDCMC Sbjct: 517 RQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMC 550 >ref|XP_003589652.1| hypothetical protein MTR_1g031590 [Medicago truncatula] gi|355478700|gb|AES59903.1| hypothetical protein MTR_1g031590 [Medicago truncatula] Length = 614 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 4 QMLSIRARSDLKGIELKRPNDSIYSFPCPDCMCH 105 Q+LS+R+ SD KG+ELKRPNDS YSFPCPDCMCH Sbjct: 579 QLLSMRSHSDSKGVELKRPNDSTYSFPCPDCMCH 612 >ref|XP_002311505.1| predicted protein [Populus trichocarpa] gi|222851325|gb|EEE88872.1| predicted protein [Populus trichocarpa] Length = 569 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 RQMLSIRARSDLKGIELKRPNDSIYSFPCPDCMCH 105 R ML++R+ SD KG E+KRPNDSIYSFPCPDCMCH Sbjct: 522 RHMLNMRSHSDSKGFEIKRPNDSIYSFPCPDCMCH 556 >ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297737694|emb|CBI26895.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 1 RQMLSIRARSDLKGIELKRPNDSIYSFPCPDCMC 102 RQML++RA SD KG ELKRPNDSIY+FPCPDCMC Sbjct: 514 RQMLNMRAHSDAKGFELKRPNDSIYTFPCPDCMC 547