BLASTX nr result
ID: Lithospermum22_contig00034371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034371 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001233805.1| monoterpene synthase 1 [Solanum lycopersicum... 62 5e-08 gb|AEM05856.1| beta myrcene/limonene synthase [Solanum lycopersi... 56 3e-06 gb|ABB30218.1| geraniol synthase [Perilla frutescens] gi|1142156... 55 6e-06 gb|AAY88965.1| geraniol synthase [Perilla citriodora] gi|7819233... 55 6e-06 gb|ACN42012.1| geraniol synthase [Perilla frutescens var. hirtella] 55 6e-06 >ref|NP_001233805.1| monoterpene synthase 1 [Solanum lycopersicum] gi|62132627|gb|AAX69063.1| monoterpene synthase 1 [Solanum lycopersicum] gi|343197038|gb|AEM05855.1| linalool synthase [Solanum lycopersicum] Length = 609 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -2 Query: 129 NVLITDEQKP--TGRRSGNYKPSIWDFNFIQSLNNPHVGEEYVKR 1 N++IT P T RRSGNYKP++WDF FIQSL+NP+ G++Y+KR Sbjct: 31 NIIITKHSHPISTTRRSGNYKPTMWDFQFIQSLHNPYEGDKYMKR 75 >gb|AEM05856.1| beta myrcene/limonene synthase [Solanum lycopersicum] Length = 592 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -2 Query: 93 RRSGNYKPSIWDFNFIQSLNNPHVGEEYVKR 1 RRSGNYKP++WDF FIQSL+NP+ G++Y+KR Sbjct: 48 RRSGNYKPTMWDFQFIQSLHNPYEGDKYMKR 78 >gb|ABB30218.1| geraniol synthase [Perilla frutescens] gi|114215673|gb|ABI54448.1| geraniol synthase [Perilla frutescens var. crispa] Length = 603 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 96 GRRSGNYKPSIWDFNFIQSLNNPHVGEEYVKR 1 GRRSGNY+PSIWDFN++QSLN P+ E Y+ R Sbjct: 59 GRRSGNYQPSIWDFNYVQSLNTPYKEERYLTR 90 >gb|AAY88965.1| geraniol synthase [Perilla citriodora] gi|78192330|gb|ABB30216.1| geraniol synthase [Perilla citriodora] gi|78192332|gb|ABB30217.1| geraniol synthase [Perilla citriodora] Length = 603 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 96 GRRSGNYKPSIWDFNFIQSLNNPHVGEEYVKR 1 GRRSGNY+PSIWDFN++QSLN P+ E Y+ R Sbjct: 59 GRRSGNYQPSIWDFNYVQSLNTPYKEERYLTR 90 >gb|ACN42012.1| geraniol synthase [Perilla frutescens var. hirtella] Length = 603 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 96 GRRSGNYKPSIWDFNFIQSLNNPHVGEEYVKR 1 GRRSGNY+PSIWDFN++QSLN P+ E Y+ R Sbjct: 59 GRRSGNYQPSIWDFNYVQSLNTPYKEERYLTR 90