BLASTX nr result
ID: Lithospermum22_contig00034346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034346 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520227.1| conserved hypothetical protein [Ricinus comm... 86 4e-15 >ref|XP_002520227.1| conserved hypothetical protein [Ricinus communis] gi|223540595|gb|EEF42160.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 85.5 bits (210), Expect = 4e-15 Identities = 46/71 (64%), Positives = 49/71 (69%), Gaps = 2/71 (2%) Frame = -3 Query: 327 PHELLTGAV--L*SFTSVWMHVLCSYSCAVNRKIVPKATTCVFLGYAHSGYRCYDVKSKR 154 PHELL GA F + VL S+SCAV RKI+PK TT VFLGYA SGYRC DVKSKR Sbjct: 2 PHELLIGAAPSYSIFECLNARVLFSFSCAVKRKIIPKETTFVFLGYAQSGYRCCDVKSKR 61 Query: 153 LDVFFNALFKG 121 LDV N LF G Sbjct: 62 LDVSLNVLFNG 72