BLASTX nr result
ID: Lithospermum22_contig00034206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034206 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633574.1| PREDICTED: protein gamma response 1-like [Vi... 61 8e-08 emb|CBI24861.3| unnamed protein product [Vitis vinifera] 61 8e-08 ref|XP_004158241.1| PREDICTED: protein gamma response 1-like [Cu... 54 1e-05 ref|XP_004136114.1| PREDICTED: protein gamma response 1-like [Cu... 54 1e-05 >ref|XP_003633574.1| PREDICTED: protein gamma response 1-like [Vitis vinifera] Length = 640 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 3/45 (6%) Frame = +2 Query: 158 PRPGVSIFKFVRPVRKKAEREK*KGIE---CKKFYDSVLPHEGNE 283 P+PG +FK+V PVR KAERE +GIE CKKFYD+VLP +GN+ Sbjct: 554 PKPGTRVFKYVEPVRTKAERENLQGIECKQCKKFYDAVLPKDGNK 598 >emb|CBI24861.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 3/45 (6%) Frame = +2 Query: 158 PRPGVSIFKFVRPVRKKAEREK*KGIE---CKKFYDSVLPHEGNE 283 P+PG +FK+V PVR KAERE +GIE CKKFYD+VLP +GN+ Sbjct: 559 PKPGTRVFKYVEPVRTKAERENLQGIECKQCKKFYDAVLPKDGNK 603 >ref|XP_004158241.1| PREDICTED: protein gamma response 1-like [Cucumis sativus] Length = 660 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/37 (67%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +2 Query: 182 KFVRPVRKKAEREK*KGIE---CKKFYDSVLPHEGNE 283 KFV PVRKKA+R+ KG+E CKKFYD+VLP++GNE Sbjct: 582 KFVEPVRKKADRQNLKGVECKQCKKFYDAVLPNDGNE 618 >ref|XP_004136114.1| PREDICTED: protein gamma response 1-like [Cucumis sativus] Length = 661 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/37 (67%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +2 Query: 182 KFVRPVRKKAEREK*KGIE---CKKFYDSVLPHEGNE 283 KFV PVRKKA+R+ KG+E CKKFYD+VLP++GNE Sbjct: 583 KFVEPVRKKADRQNLKGVECKQCKKFYDAVLPNDGNE 619