BLASTX nr result
ID: Lithospermum22_contig00034146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034146 (629 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana... 103 2e-20 dbj|BAF00743.1| hypothetical protein [Arabidopsis thaliana] 103 2e-20 emb|CAB66410.1| putative protein [Arabidopsis thaliana] 103 2e-20 ref|XP_002877664.1| hypothetical protein ARALYDRAFT_906210 [Arab... 102 6e-20 ref|XP_002515682.1| conserved hypothetical protein [Ricinus comm... 100 3e-19 >ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana] gi|12324434|gb|AAG52174.1|AC012329_1 putative transporter; 8780-5873 [Arabidopsis thaliana] gi|40823305|gb|AAR92274.1| At3g49310 [Arabidopsis thaliana] gi|46518411|gb|AAS99687.1| At3g49310 [Arabidopsis thaliana] gi|332645006|gb|AEE78527.1| major facilitator protein [Arabidopsis thaliana] Length = 460 Score = 103 bits (258), Expect = 2e-20 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = +3 Query: 3 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLCVISEKPKSQDWTPLTERDAD 173 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRL VISEKPK++DW+P+ ER+++ Sbjct: 398 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLMVISEKPKAEDWSPMKERNSE 454 >dbj|BAF00743.1| hypothetical protein [Arabidopsis thaliana] Length = 460 Score = 103 bits (258), Expect = 2e-20 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = +3 Query: 3 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLCVISEKPKSQDWTPLTERDAD 173 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRL VISEKPK++DW+P+ ER+++ Sbjct: 398 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLMVISEKPKAEDWSPMKERNSE 454 >emb|CAB66410.1| putative protein [Arabidopsis thaliana] Length = 482 Score = 103 bits (258), Expect = 2e-20 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = +3 Query: 3 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLCVISEKPKSQDWTPLTERDAD 173 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRL VISEKPK++DW+P+ ER+++ Sbjct: 420 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLMVISEKPKAEDWSPMKERNSE 476 >ref|XP_002877664.1| hypothetical protein ARALYDRAFT_906210 [Arabidopsis lyrata subsp. lyrata] gi|297323502|gb|EFH53923.1| hypothetical protein ARALYDRAFT_906210 [Arabidopsis lyrata subsp. lyrata] Length = 460 Score = 102 bits (254), Expect = 6e-20 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +3 Query: 3 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLCVISEKPKSQDWTPLTERDAD 173 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRL VISEKPK+++W+P+ ER+++ Sbjct: 398 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLMVISEKPKAEEWSPMKERNSE 454 >ref|XP_002515682.1| conserved hypothetical protein [Ricinus communis] gi|223545225|gb|EEF46734.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 100 bits (248), Expect = 3e-19 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +3 Query: 3 IFVCIVLYNVDAFPITIMFGMCSIFLFVASILQRRLCVISEKPKSQDWTPLTERDADDE 179 IFVCIVLYNV+AFPIT+MFGMCSIFLF+ASILQRRL VIS+KPK++DWT L +RD + E Sbjct: 398 IFVCIVLYNVNAFPITVMFGMCSIFLFMASILQRRLMVISDKPKAEDWTALKDRDTEAE 456