BLASTX nr result
ID: Lithospermum22_contig00034115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00034115 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525795.1| ATP synthase gamma chain 2, chloroplast, put... 94 1e-17 ref|XP_002892875.1| hypothetical protein ARALYDRAFT_888960 [Arab... 92 4e-17 ref|NP_173022.1| ATP synthase gamma chain 2 [Arabidopsis thalian... 92 4e-17 ref|XP_002518477.1| ATP synthase gamma chain 2, chloroplast, put... 90 2e-16 ref|XP_004145113.1| PREDICTED: ATP synthase gamma chain, chlorop... 90 2e-16 >ref|XP_002525795.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] gi|223534945|gb|EEF36631.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] Length = 381 Score = 94.0 bits (232), Expect = 1e-17 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = +3 Query: 3 ILKALQESFASELSSRMNAMSNATDNAADLKRDLSIQYNRGRQSKITNEILEIVAGAEAL 182 IL+ALQES ASEL++RMNAMSNATDNA DL++ LSI YNR RQSKIT EILEIVAGAEAL Sbjct: 318 ILRALQESLASELAARMNAMSNATDNAVDLQKSLSIAYNRERQSKITGEILEIVAGAEAL 377 >ref|XP_002892875.1| hypothetical protein ARALYDRAFT_888960 [Arabidopsis lyrata subsp. lyrata] gi|297338717|gb|EFH69134.1| hypothetical protein ARALYDRAFT_888960 [Arabidopsis lyrata subsp. lyrata] Length = 381 Score = 92.0 bits (227), Expect = 4e-17 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = +3 Query: 3 ILKALQESFASELSSRMNAMSNATDNAADLKRDLSIQYNRGRQSKITNEILEIVAGAEAL 182 IL+ALQES ASEL+SRMNAMSNATDNA +LK++L++ YNR RQ+KIT E+LEIVAGAEAL Sbjct: 319 ILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEAL 378 >ref|NP_173022.1| ATP synthase gamma chain 2 [Arabidopsis thaliana] gi|461551|sp|Q01909.1|ATPG2_ARATH RecName: Full=ATP synthase gamma chain 2, chloroplastic; AltName: Full=F-ATPase gamma subunit 2; Flags: Precursor gi|8927649|gb|AAF82140.1|AC034256_4 Identical to ATP sythase gamma subunit (atpC2) from Arabidopsis thaliana gb|M61742 and contains an ATP synthase PF|00231 domain [Arabidopsis thaliana] gi|166788|gb|AAA32833.1| ATP synthase gamma-subunit [Arabidopsis thaliana] gi|17529042|gb|AAL38731.1| putative ATP synthase gamma-subunit [Arabidopsis thaliana] gi|21436197|gb|AAM51386.1| putative ATP synthase gamma-subunit [Arabidopsis thaliana] gi|332191230|gb|AEE29351.1| ATP synthase gamma chain 2 [Arabidopsis thaliana] Length = 386 Score = 92.0 bits (227), Expect = 4e-17 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = +3 Query: 3 ILKALQESFASELSSRMNAMSNATDNAADLKRDLSIQYNRGRQSKITNEILEIVAGAEAL 182 IL+ALQES ASEL+SRMNAMSNATDNA +LK++L++ YNR RQ+KIT E+LEIVAGAEAL Sbjct: 324 ILRALQESLASELASRMNAMSNATDNAVELKKNLTMAYNRARQAKITGELLEIVAGAEAL 383 >ref|XP_002518477.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] gi|223542322|gb|EEF43864.1| ATP synthase gamma chain 2, chloroplast, putative [Ricinus communis] Length = 376 Score = 90.1 bits (222), Expect = 2e-16 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +3 Query: 3 ILKALQESFASELSSRMNAMSNATDNAADLKRDLSIQYNRGRQSKITNEILEIVAGAEAL 182 ILKALQES ASEL++RM+AMSNA+DNAA+LK+ LSI YNR RQ+KIT EILEIVAGA AL Sbjct: 316 ILKALQESLASELAARMSAMSNASDNAAELKKTLSIVYNRARQAKITGEILEIVAGANAL 375 >ref|XP_004145113.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] gi|449474626|ref|XP_004154236.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] gi|449488358|ref|XP_004158011.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Cucumis sativus] Length = 373 Score = 89.7 bits (221), Expect = 2e-16 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +3 Query: 3 ILKALQESFASELSSRMNAMSNATDNAADLKRDLSIQYNRGRQSKITNEILEIVAGAEAL 182 IL+ALQES ASEL++RM+AMSNATDNA++LKR LSI YNR RQ+KIT EILEIVAGA AL Sbjct: 313 ILRALQESLASELAARMSAMSNATDNASELKRTLSIVYNRQRQAKITGEILEIVAGANAL 372