BLASTX nr result
ID: Lithospermum22_contig00033912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033912 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324235.1| predicted protein [Populus trichocarpa] gi|2... 113 2e-23 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 111 7e-23 ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 111 7e-23 ref|XP_003525660.1| PREDICTED: pentatricopeptide repeat-containi... 106 2e-21 ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago t... 106 2e-21 >ref|XP_002324235.1| predicted protein [Populus trichocarpa] gi|222865669|gb|EEF02800.1| predicted protein [Populus trichocarpa] Length = 736 Score = 113 bits (282), Expect = 2e-23 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 2 STKPGTTLRIVKNLRVCNNCHTATRLISSIFKREIIARDRNRFHHFKDGSCSCMDYW 172 STKPGTT+RI+KNLRVC NCH+AT+LIS IF REIIARDRNRFHHFKDGSCSC DYW Sbjct: 680 STKPGTTIRIMKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCKDYW 736 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 111 bits (277), Expect = 7e-23 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +2 Query: 2 STKPGTTLRIVKNLRVCNNCHTATRLISSIFKREIIARDRNRFHHFKDGSCSCMDYW 172 STKPGT +RI+KNLRVC NCH+AT+LIS IF REIIARDRNRFHHFKDGSCSC DYW Sbjct: 678 STKPGTPIRIIKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDYW 734 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 111 bits (277), Expect = 7e-23 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +2 Query: 2 STKPGTTLRIVKNLRVCNNCHTATRLISSIFKREIIARDRNRFHHFKDGSCSCMDYW 172 STKP TT+RIVKNLRVC NCH+A +LIS IF REIIARDRNRFHHFKDGSCSCMDYW Sbjct: 682 STKPETTIRIVKNLRVCGNCHSAIKLISKIFNREIIARDRNRFHHFKDGSCSCMDYW 738 >ref|XP_003525660.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 736 Score = 106 bits (265), Expect = 2e-21 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 2 STKPGTTLRIVKNLRVCNNCHTATRLISSIFKREIIARDRNRFHHFKDGSCSCMDYW 172 STKPG+T+RIVKNLRVC NCH+AT+LIS IF REIIARDRNRFHHFKDG CSC D W Sbjct: 680 STKPGSTIRIVKNLRVCRNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDRW 736 >ref|XP_003609266.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510321|gb|AES91463.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 738 Score = 106 bits (265), Expect = 2e-21 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +2 Query: 5 TKPGTTLRIVKNLRVCNNCHTATRLISSIFKREIIARDRNRFHHFKDGSCSCMDYW 172 TKPGTT+RIVKNLRVC NCH+AT+LIS IF REIIARDRNRFHHFKDG CSC D W Sbjct: 683 TKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGFCSCNDCW 738